DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnaja2

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis

Alignment Length:408 Identity:201/409 (49%)
Similarity:266/409 (65%) Gaps:16/409 (4%)


  Fly     2 VKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDE 66
            |.:|..||||||.|.|:.::|||||||||.:||||||||.|:|||.||.||||||:.:||::||.
 Frog     4 VADTKLYDILGVAPGASENDLKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDR 68

  Fly    67 GGEAAIKKGGADSG-DFRNPMDFFEKFFGAGFGGSGGGRRR----ERRGKDVVHQMSVQLEELYN 126
            .||..:::|...|| |     |.|...||.|..|..||:.|    .|||:|::|.:.|.||:|||
 Frog    69 YGEQGLREGSGGSGMD-----DIFSHIFGGGLFGFMGGQSRSRNGRRRGEDMMHPLKVSLEDLYN 128

  Fly   127 GATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGE 191
            |.|.||||.|||:|..|.|:|||.|:::||..|||.||...::|:|||::|.::.||..|:|.||
 Frog   129 GKTTKLQLSKNVLCSSCNGQGGKTGAVQKCSACRGRGVRVMIRQLAPGMVQQMQSVCSDCNGEGE 193

  Fly   192 TIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHST 256
            .|.||||||.|.|:|.|:|.|::|||::|||:.||:|.|:||.|..|..:||||:::|.||||..
 Frog   194 VINEKDRCKKCEGKKVVKEVKIIEVHVDKGMKHGQRITFSGEADQAPGVEPGDIVLVLQEKEHEV 258

  Fly   257 FAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPM 321
            |...|.||.|...:.|||||||||...|.||.|.::|...||:||.....:.:..||||.::||.
 Frog   259 FQRDGNDLHMTHRIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGSVRVVRGEGMPQYRNPF 323

  Fly   322 EKGTLIIQFEVIFPE--VINPSVVPTLKQCLPPAPEVD-IPIDAEQTVLEDFDPKQRRQQHQRM- 382
            |||.|.|:|:|||||  .|||..:..|:..||..||.. :..:.|:..|::||..:.....||. 
 Frog   324 EKGDLFIKFDVIFPENNWINPDKLTELEDLLPSRPEAPAVSGETEEVDLQEFDNTRGSSGGQRRE 388

  Fly   383 AYDE--DDGGYQDGPRVQ 398
            ||::  ||.....||.||
 Frog   389 AYNDSSDDESSHHGPGVQ 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 200/407 (49%)
DnaJ 7..65 CDD:278647 40/58 (69%)
DnaJ_C 112..336 CDD:199909 117/224 (52%)
DnaJ_zf 140..206 CDD:199908 34/66 (52%)
dnaja2NP_001004807.1 PTZ00037 4..410 CDD:240236 201/409 (49%)
DnaJ 9..67 CDD:278647 40/58 (69%)
DnaJ_C 113..339 CDD:199909 118/226 (52%)
DnaJ_zf 142..208 CDD:199908 34/66 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012379at2759
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R684
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.