DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajb4

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001003455.1 Gene:dnajb4 ZFINID:ZDB-GENE-040801-192 Length:340 Species:Danio rerio

Alignment Length:398 Identity:117/399 (29%)
Similarity:185/399 (46%) Gaps:117/399 (29%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.|||:...|:.|::||||||.|||:|||||  .|..||||.:::|||||||..||::||:.||
Zfish     5 YYKILGITKGASDDDIKKAYRKQALKWHPDKNKAANAEEKFKEVAEAYEVLSDPKKREIYDQYGE 69

  Fly    70 AAIKKGGADS----GDFR-----NPMDFFEKFFGAG--------------------------FG- 98
            ..:|.||..|    |:|.     :|...|..|||..                          || 
Zfish    70 EGLKGGGGASDGPGGNFTYTFHGDPHATFATFFGGASPFEVFFGRKVNGRDEDDMEVDGNDPFGS 134

  Fly    99 ---------------GSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGG 148
                           |.||..|| ::...:.|::.|.|||:::|:|:::::.:            
Zfish   135 FTSFNINGFPRERHVGQGGPPRR-KQDPAIHHELRVSLEEVFHGSTKRMKISR------------ 186

  Fly   149 KKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKV 213
                                               ::.:..|.|::.:|              |:
Zfish   187 -----------------------------------KRLNPDGRTLRTED--------------KI 202

  Fly   214 LEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCG 278
            |.:.|::|.::|.||.|..|||..|.:.|.||:.::.:|.|..|...|.|::..:.:.|.::|||
Zfish   203 LTIEIKRGWKEGTKITFPREGDETPNTIPADIVFVIKDKPHGHFRREGSDIVYPVRVSLRQSLCG 267

  Fly   279 FQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVV 343
            ....|.|:|.:  ..:.:..:||:..|.|.||.:|:|..|||.::|.||::|:|.|||.:..:..
Zfish   268 CSVTVSTIDGK--TCNMKITDVIKPGMRKVIAGQGLPFPKNPEQRGDLIVEFDVNFPESLPTNAK 330

  Fly   344 PTLKQCLP 351
            ..||:.||
Zfish   331 DVLKRHLP 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 117/399 (29%)
DnaJ 7..65 CDD:278647 36/60 (60%)
DnaJ_C 112..336 CDD:199909 55/224 (25%)
DnaJ_zf 140..206 CDD:199908 3/66 (5%)
dnajb4NP_001003455.1 DnaJ 1..334 CDD:223560 114/393 (29%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 163..325 CDD:199909 56/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.