DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and CG8476

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_731777.1 Gene:CG8476 FlyBaseID:FBgn0038127 Length:242 Species:Drosophila melanogaster

Alignment Length:66 Identity:23/67 (34%)
Similarity:39/67 (58%) Gaps:2/67 (3%)


  Fly     2 VKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVY 64
            ::...:|.:|.|...::..|:|:|:.:|:.|||||.|  ..:.|.|..|.:||:.|...:.||:|
  Fly    33 LRAENHYQVLNVPVGSSDREIKRAFIELSKKYHPDANSQTRDSEVFMKICEAYQTLHRVNSRQIY 97

  Fly    65 D 65
            |
  Fly    98 D 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 23/67 (34%)
DnaJ 7..65 CDD:278647 22/60 (37%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
CG8476NP_731777.1 DnaJ 37..98 CDD:278647 22/61 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.