DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and DnaJ-1

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster

Alignment Length:393 Identity:118/394 (30%)
Similarity:169/394 (43%) Gaps:112/394 (28%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            :|.|||::..|:.||:||||||||||||||||  |...|:||.|::|||||||..||.::|..||
  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGE 69

  Fly    70 AAIKKG--GADSG--------DFR-NPMDFFEKFFGAG-------------FGGSGGGRRRE--- 107
            ..:|.|  |.|.|        .|. :|...|.:|||:.             |.|..||...|   
  Fly    70 DGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTNEIFW 134

  Fly   108 -----------------RRGKD--VVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSI 153
                             :|.:|  :.|.:.|.|||:..|..:|:::.:                 
  Fly   135 NIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISR----------------- 182

  Fly   154 EKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHI 218
               :....||                                           ..:|.|||.:.:
  Fly   183 ---MATGSNG-------------------------------------------PYKEEKVLRITV 201

  Fly   219 EKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIV 283
            :.|.:.|.||.|..|||..|...|.||:.::.:|.||.|...|.||.....:.|.:||||....|
  Fly   202 KPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSV 266

  Fly   284 KTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQ 348
            .||....:.|:.. .|:|:...|:.|...|:|:.|.|..:|.||:.|::.||:.:.||:...|.:
  Fly   267 PTLQGSRIQVNPN-HEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSE 330

  Fly   349 CLP 351
            .||
  Fly   331 LLP 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 118/394 (30%)
DnaJ 7..65 CDD:278647 37/60 (62%)
DnaJ_C 112..336 CDD:199909 56/226 (25%)
DnaJ_zf 140..206 CDD:199908 2/66 (3%)
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 117/392 (30%)
DnaJ 4..65 CDD:278647 37/60 (62%)
DnaJ_C 157..320 CDD:199909 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.