DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and DnaJ-60

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_523840.1 Gene:DnaJ-60 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster

Alignment Length:69 Identity:20/70 (29%)
Similarity:39/70 (56%) Gaps:5/70 (7%)


  Fly     3 KETGYYDILGVKPNATPDELKKAYRKLALKYHPDKN-----PNEGEKFKAISQAYEVLSDADKRQ 62
            |...:|::|.::.:.:..|::.|:.:|:..||||..     |....:|..||:||:.|...::|:
  Fly    23 KPETHYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRR 87

  Fly    63 VYDE 66
            .||:
  Fly    88 DYDD 91

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 20/70 (29%)
DnaJ 7..65 CDD:278647 18/63 (29%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:278647 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.