DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and CG8531

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster

Alignment Length:449 Identity:92/450 (20%)
Similarity:165/450 (37%) Gaps:108/450 (24%)


  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEK------FKAISQAYEVLSDADKRQ 62
            :..||..|.:..:||.:::..||||.:..:||||:.:...|      |....:|||||||..:|.
  Fly    13 DENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRA 77

  Fly    63 VYDEGGEAAIKKGGAD-SGDFRNPMDFFEKFFGAGFGGSGGGRRRER----RGKDVVHQMSVQLE 122
            :||..||..::..|.: ....:.|.:..|::  .....:...||.::    ||...::..:.::.
  Fly    78 IYDSVGEKGLRTEGWEILHRTKTPDEIREEY--ERLAQAAAERRLQQRTNPRGNITINVNATEIF 140

  Fly   123 ELYNGA--------------------TRK--LQLQKNVICDKCEGRGG---------KKGSIEKC 156
            ..|:.:                    |||  :.:..|:......|.||         .||.||.|
  Fly   141 APYDDSEMPHVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGSGGFVIAGRRLLNKGWIELC 205

  Fly   157 LQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKV-------L 214
            ... |||....::                   .|.|:.:| ...|.......|::.|       |
  Fly   206 AGA-GNGFLLGLK-------------------GGRTLSQK-LTLNGGTNLNFRDQGVIPALFSTL 249

  Fly   215 EVHIEK------GMRDGQKIVFTGEGDHEPE--SQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQ 271
            .|.::|      .:..|.:...:.:.||..|  |....::|   ...|..|..:....||:..|:
  Fly   250 AVQLDKHTMGSLTLNAGSQSSMSTQIDHSKETYSLSSSLVI---GTPHVYFGLSYTRKMMENELK 311

  Fly   272 LVEA-------LCGFQRIVKTLDDRDLIVST-----QPGEVIRHEMTKCIAEEGMPIFKNPMEKG 324
            |..|       ..|...:.|.:.....:.:|     ..|.:::.::.:.......||.       
  Fly   312 LKLAAKVGTFGFMGEYGVEKKVSKYSSVTATVSIGVPSGVILKFKILRSNQSYVFPIH------- 369

  Fly   325 TLIIQFEVIFPEVINPSVVPTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQRRQQHQRMA 383
               :..|::...|...||.|.:.........:| |::||:..:|  ..:.:||..||::
  Fly   370 ---LSDEIVPAAVFYASVTPVIAWFFIKRTVMD-PMEAERKNIE--VERTKRQNEQRLS 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 92/450 (20%)
DnaJ 7..65 CDD:278647 24/64 (38%)
DnaJ_C 112..336 CDD:199909 45/282 (16%)
DnaJ_zf 140..206 CDD:199908 15/75 (20%)
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 27/76 (36%)
DnaJ 15..80 CDD:278647 24/65 (37%)
DUF3395 409..538 CDD:288708 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.