DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and Dnajc25

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001020192.1 Gene:Dnajc25 RGDID:1561488 Length:357 Species:Rattus norvegicus

Alignment Length:69 Identity:27/70 (39%)
Similarity:41/70 (59%) Gaps:11/70 (16%)


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDK---NPNEG--------EKFKAISQAYEVLSDADKR 61
            |::|||..:|:..|:.:|||:||.:||||:   .|.:|        |.|..::.|||.|.|.:.|
  Rat    50 YEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETR 114

  Fly    62 QVYD 65
            :.||
  Rat   115 KDYD 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 27/70 (39%)
DnaJ 7..65 CDD:278647 26/68 (38%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
Dnajc25NP_001020192.1 DnaJ 47..>118 CDD:223560 26/68 (38%)
DnaJ 48..118 CDD:278647 26/68 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.