DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and CG5001

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:409 Identity:121/410 (30%)
Similarity:172/410 (42%) Gaps:128/410 (31%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.|||:...||.||:|||||||||:||||||  .|..:|||.:::|||||||..||:|||:.||
  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGE 69

  Fly    70 AAIKKGGADS-------------GDFR----------NPM--------DFFEK----------FF 93
            ..:|.||..:             ||.|          ||.        :.|:|          ||
  Fly    70 DGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFF 134

  Fly    94 GAGFGGSGGG----------------------RRRERRGKDVVHQMSVQLEELYNGATRKLQLQK 136
            .:.|||.|..                      ::.:::...|.|.:.|.|||:|:|..:|:::.:
  Fly   135 SSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISR 199

  Fly   137 NVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKN 201
            .::                  |..|                                        
  Fly   200 RIV------------------QADG---------------------------------------- 206

  Fly   202 CSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMM 266
             |.||   |.|.|.:.|:.|.:.|.|:.|..|||..|...|.||:.::.:|.|:.|...|.||..
  Fly   207 -SSRK---EEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRY 267

  Fly   267 KMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFE 331
            ...|.|.:||||....|.|:....|.:||.. |:|:....|.|...|:|..|:...||.|::.|:
  Fly   268 TARLTLKQALCGVVFQVPTMSGDKLRISTMQ-EIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFD 331

  Fly   332 VIFPEVINPSVVPTLKQCL 350
            :.|||.:..:....||..|
  Fly   332 IQFPEKLTAAQKEVLKDML 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 121/410 (30%)
DnaJ 7..65 CDD:278647 39/60 (65%)
DnaJ_C 112..336 CDD:199909 59/224 (26%)
DnaJ_zf 140..206 CDD:199908 4/66 (6%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 119/405 (29%)
DnaJ 4..65 CDD:278647 39/60 (65%)
DnaJ_C 174..338 CDD:199909 60/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.