DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnaja2b

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_997830.1 Gene:dnaja2b ZFINID:ZDB-GENE-030131-2884 Length:413 Species:Danio rerio

Alignment Length:409 Identity:196/410 (48%)
Similarity:265/410 (65%) Gaps:15/410 (4%)


  Fly     2 VKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDE 66
            |.:|..||:|||.|:|:.:||||||||||.:||||||||.|:|||.||.|||||::.:|:.:||.
Zfish     4 VADTKLYDLLGVSPSASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLTNPEKKDLYDR 68

  Fly    67 GGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRE------RRGKDVVHQMSVQLEELY 125
            .||..:::||.......   |.|...||.|..|..||:..:      |||:|::|.:.|.||:||
Zfish    69 YGEQGLREGGGGGAGME---DIFSHIFGGGLFGFMGGQSSKSRNGGRRRGEDMIHPLKVSLEDLY 130

  Fly   126 NGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTG 190
            ||.|.||||.|||:|..|.|:|||.|:::||..|||.|:...::|:|||::|.::.||..|:|.|
Zfish   131 NGKTTKLQLSKNVLCSACNGQGGKTGAVQKCSTCRGRGMRIMIRQLAPGMVQQMQSVCTDCNGEG 195

  Fly   191 ETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHS 255
            |.|.||||||.|.|||..:|.||||||::|||:.||||.|:||.|..|.::|||||::|.||:|.
Zfish   196 EVIHEKDRCKECDGRKVCKEVKVLEVHVDKGMKHGQKITFSGEADQSPNTEPGDIILVLQEKDHE 260

  Fly   256 TFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNP 320
            .|...|.||.:...:.|||||||||.::..||.|.|::...||:|:.....:.:..||||.::||
Zfish   261 EFRRDGNDLHIGHKIGLVEALCGFQFMLTHLDGRHLVIKYPPGKVVEPGSIRVVRGEGMPQYRNP 325

  Fly   321 MEKGTLIIQFEVIFPE--VINPSVVPTLKQCLPPAPEVD-IPIDAEQTVLEDFDPKQRRQ-QHQR 381
            .|||.|.|:|:|.|||  .|:...:..|:..||...||. |..|.|:..|:|||..|... .|:|
Zfish   326 FEKGDLFIKFDVQFPENGWISTEKLSELEDLLPSRTEVPVISADTEEVDLQDFDMSQGSSGGHRR 390

  Fly   382 MAYDE--DDGGYQDGPRVQ 398
            .||::  |:.|...||.||
Zfish   391 EAYNDSSDEEGGPHGPGVQ 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 195/408 (48%)
DnaJ 7..65 CDD:278647 38/58 (66%)
DnaJ_C 112..336 CDD:199909 115/224 (51%)
DnaJ_zf 140..206 CDD:199908 34/66 (52%)
dnaja2bNP_997830.1 PTZ00037 4..413 CDD:240236 196/410 (48%)
DnaJ 9..67 CDD:278647 38/58 (66%)
DnaJ_C 116..342 CDD:199909 116/226 (51%)
DnaJ_zf 145..211 CDD:199908 34/66 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012379at2759
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126883
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.