DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnaja1

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_955956.1 Gene:dnaja1 ZFINID:ZDB-GENE-030131-2642 Length:398 Species:Danio rerio

Alignment Length:414 Identity:233/415 (56%)
Similarity:294/415 (71%) Gaps:27/415 (7%)


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            ||||||:||:|||||:|:|:|||||||||||||||||||.||||||.|||||||||||.||:|||
Zfish     1 MVKETGFYDMLGVKPSASPEELKKAYRKLALKYHPDKNPTEGEKFKQISQAYEVLSDAKKREVYD 65

  Fly    66 EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGR-RRERRGKDVVHQMSVQLEELYNGAT 129
            .|||.|||:||  :|...:|||.|:.|||      |||| .||||||:||||::|.||:||||.|
Zfish    66 RGGEKAIKEGG--NGGSCSPMDIFDLFFG------GGGRMHRERRGKNVVHQLTVSLEDLYNGTT 122

  Fly   130 RKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQ 194
            |||.|||||||||||||||:||.||.|..|||.||:.|:..:|||::|.|..||..|.|.|:.:.
Zfish   123 RKLALQKNVICDKCEGRGGRKGVIEVCPLCRGVGVQVRLHHLAPGMVQQISTVCEGCQGQGQRLG 187

  Fly   195 EKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAH 259
            .:||||.|:|||.:|::|:|||||:|||:|||||||.||||.||..:||||||:||::.|..:..
Zfish   188 HRDRCKTCTGRKILRQKKILEVHIDKGMKDGQKIVFHGEGDQEPGLKPGDIIIVLDQRAHPLYTR 252

  Fly   260 AGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKG 324
            .|.||::.|.|||||:|||||:.:||||.|.|::::.|||:|:....||:..||||:.:.|.|||
Zfish   253 QGDDLIVSMELQLVESLCGFQKPIKTLDSRTLLITSHPGELIKPGDKKCVMNEGMPMHRRPFEKG 317

  Fly   325 TLIIQFEVIFPE--VINPSVVPTLKQCLPPAPE--------VDIPIDAEQTVLEDFDPKQRRQQH 379
            .|||...|:|||  .:..:.:..|::.||...|        .|:.|.|:   |||.|....|..:
Zfish   318 KLIIHSNVVFPEENFLPLNKLKELERFLPNKQENMESDSMDDDLYIYAD---LEDCDLSHERHHY 379

  Fly   380 QRMAYDEDDGGYQDGPRVQQCTSS 403
            .   |.|::..|..|.  .||.:|
Zfish   380 H---YIEEEDFYPSGG--VQCQTS 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 229/407 (56%)
DnaJ 7..65 CDD:278647 49/58 (84%)
DnaJ_C 112..336 CDD:199909 131/224 (58%)
DnaJ_zf 140..206 CDD:199908 37/66 (56%)
dnaja1NP_955956.1 PTZ00037 2..395 CDD:240236 230/409 (56%)
DnaJ 7..65 CDD:278647 49/58 (84%)
DnaJ_C 104..330 CDD:199909 133/226 (59%)
DnaJ_zf 133..199 CDD:199908 37/66 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89575747
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1012379at2759
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126883
Panther 1 1.100 LDO PTHR43888
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.