DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajc3a

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_955904.2 Gene:dnajc3a ZFINID:ZDB-GENE-030131-1264 Length:504 Species:Danio rerio

Alignment Length:105 Identity:42/106 (40%)
Similarity:58/106 (55%) Gaps:11/106 (10%)


  Fly     3 KETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKA------ISQAYEVLSDADKR 61
            |:..||.|||||..|...|:.|||||||.::|||...:..||.||      |:||.|||:|.:.|
Zfish   391 KKRDYYKILGVKRTAQKKEILKAYRKLAQQWHPDNFQDAEEKKKAEKKFIDIAQAKEVLTDPEMR 455

  Fly    62 QVYDEGG---EAAIKKGGADSGDFRNPMDFFEKF--FGAG 96
            ..:|:|.   :...::||.....|....:.|:.|  ||:|
Zfish   456 SKFDQGEDPMDPESQQGGGHHHHFHGGWENFQGFNPFGSG 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 42/106 (40%)
DnaJ 7..65 CDD:278647 31/64 (48%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
dnajc3aNP_955904.2 TPR repeat 37..65 CDD:276809
TPR_11 38..102 CDD:290150
TPR repeat 70..100 CDD:276809
TPR_11 73..136 CDD:290150
TPR_1 73..104 CDD:278916
TPR repeat 105..133 CDD:276809
TPR repeat 157..182 CDD:276809
TPR_11 194..252 CDD:290150
TPR repeat 221..251 CDD:276809
TPR repeat 256..281 CDD:276809
LcrH_SycD 262..389 CDD:274197
TPR repeat 301..335 CDD:276809
TPR repeat 340..368 CDD:276809
TPR repeat 374..397 CDD:276809 3/6 (50%)
DnaJ 391..>502 CDD:223560 42/106 (40%)
DnaJ 394..459 CDD:278647 31/65 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.