DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and CG2887

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_572633.1 Gene:CG2887 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster

Alignment Length:358 Identity:106/359 (30%)
Similarity:172/359 (48%) Gaps:36/359 (10%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.|||::..|...|::|||.|.||:||||||  |...|.||.:::|||||||..||..||...:
  Fly     5 YYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSRND 69

  Fly    70 AAIKKGGADSGD-FRNPMDFFEKFFGAGF---GGSGGGRRRERRGK-----DVVHQMSVQLEELY 125
            ...::..|:.|. |.:...|.....|:|.   |||||||:...|..     |.....|...|::.
  Fly    70 KGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFFEDIE 134

  Fly   126 NGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTG 190
            |    ......:|:.      ||..|:.::  :|.....::.::.:   |...:|.:...|:   
  Fly   135 N----DFDSDDDVLL------GGGAGAPKR--RCEQQSPQSSIEHV---IYVALEDIANGCN--- 181

  Fly   191 ETIQEKDRCKNCSGRK---TVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEK 252
                .:.:....|||.   .|:..::|.|.|..|.:.|.||.|..||...|..:|.:::.::.:|
  Fly   182 ----RRMKISRASGRNGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVFIIRDK 242

  Fly   253 EHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIF 317
            .|..|...|.:|:....:.|.:||||...:|.||..|.:.:.|..||||..:..:.|...|:|..
  Fly   243 PHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRILGYGLPDS 307

  Fly   318 KNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCL 350
            .|...:|:::::|.:.||:.|:..:..:|.:.|
  Fly   308 INNSRRGSIVVRFSIQFPDAISKELASSLDRLL 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 106/359 (30%)
DnaJ 7..65 CDD:278647 33/60 (55%)
DnaJ_C 112..336 CDD:199909 55/227 (24%)
DnaJ_zf 140..206 CDD:199908 10/66 (15%)
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 104/348 (30%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 163..326 CDD:199909 46/173 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.