DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and Dnajb5

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006238132.1 Gene:Dnajb5 RGDID:1307453 Length:461 Species:Rattus norvegicus

Alignment Length:405 Identity:128/406 (32%)
Similarity:186/406 (46%) Gaps:123/406 (30%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.|||:...|..||:||||||:|||||||||  ||..||||.|::||:||||..||.:||:.||
  Rat   118 YYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQYGE 182

  Fly    70 AAIKKGGADS----GDFR------------------NPMDFF----------------------- 89
            ..:|.||..|    |.|.                  ||.|.|                       
  Rat   183 EGLKTGGGTSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDED 247

  Fly    90 EKFFGA----GFGGSGGGRRR-------ERRGKD--VVHQMSVQLEELYNGATRKLQLQKNVICD 141
            |..|||    ||.|...|.||       .|:.:|  |||::.|.|||:|:|:|:::::.:     
  Rat   248 EDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITR----- 307

  Fly   142 KCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRK 206
                                                      |:.:..|.|::.:|         
  Rat   308 ------------------------------------------RRLNPDGRTVRTED--------- 321

  Fly   207 TVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQ 271
                 |:|.:.|::|.::|.||.|..|||..|::.|.||:.:|.:|.|:.|...|.:::....:.
  Rat   322 -----KILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALIS 381

  Fly   272 LVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPE 336
            |.|||||....:.|:|.|  ::.....:||:....|.:..||:|..|.|.::|.||::|:|.||:
  Rat   382 LKEALCGCTVNIPTIDGR--VIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPD 444

  Fly   337 VINPSVVPTLKQCLP 351
            .:.|.....|||.||
  Rat   445 RLTPQTRQILKQHLP 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 128/406 (32%)
DnaJ 7..65 CDD:278647 39/60 (65%)
DnaJ_C 112..336 CDD:199909 59/226 (26%)
DnaJ_zf 140..206 CDD:199908 4/66 (6%)
Dnajb5XP_006238132.1 DnaJ 113..456 CDD:223560 125/401 (31%)
DnaJ 117..178 CDD:278647 39/60 (65%)
DnaJ_C 282..446 CDD:199909 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.