DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and SPBC1347.05c

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_596697.3 Gene:SPBC1347.05c PomBaseID:SPBC1347.05c Length:398 Species:Schizosaccharomyces pombe

Alignment Length:377 Identity:122/378 (32%)
Similarity:180/378 (48%) Gaps:62/378 (16%)


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNP-NE--GEKFKAISQAYEVLSDADKRQ 62
            :|....||.||||..:|:..|::||||:|..::|||||| ||  .|||..|::|:|||||.::|:
pombe    19 VVSAADYYQILGVSKDASESEIRKAYRQLTKQWHPDKNPGNEEAQEKFIEINKAHEVLSDPEQRK 83

  Fly    63 VYDEGGEAAI--KKGGADSGDFRNPMDFFEKFFGAGFGGSG--------------GGRRRE---R 108
            :||..||..:  :.||...|.            |.||.|.|              |||||:   |
pombe    84 IYDAYGEEGLNGQPGGPGGGP------------GEGFPGGGFGFDPFGDIFDNIFGGRRRQNAVR 136

  Fly   109 RGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRG-----GKKGSIEKCLQCRGNGVETRV 168
            ||..:...:.:.|...|.|.:..|::.....|..|.|:|     ....:||.|..|.|:|.....
pombe   137 RGPSMEQIVQIHLSSFYTGGSFTLEIPVKRTCSVCSGQGFNPKYSADKAIESCPVCGGSGFRVIE 201

  Fly   169 QQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGE 233
            ..||||..|.:...|..|:|.|.||  |.:|..|.|.:.....:..::.:..|..:|.:|.|.|:
pombe   202 HMIAPGFRQQMRMPCNACNGNGRTI--KHKCPRCKGERVAEVVESFDIKVPAGAPEGYRIGFRGK 264

  Fly   234 GDHEPESQPGDIIILLDEKEHSTFAHAG--------QDLMMKMPLQLVEALCG-FQRIVKTLDDR 289
            .|..|..:.||||::|:       |..|        .||..|..:.:.|||.| ::|.::.||..
pombe   265 ADEIPGMEAGDIIVILE-------AAGGDYGWTRKDNDLYRKETISVREALLGNWKRKIQKLDGS 322

  Fly   290 DLIVSTQPGEVIRHEMTKCIAEEGMPIF-----KNPMEKGTLIIQFEVIFPE 336
            .:.|....|||:....|:.:..:||||:     |.....|:..|::||.||:
pombe   323 FMEVKRSAGEVVHPGETERVKNQGMPIYNLHKGKTTSAHGSAYIEWEVKFPK 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 122/377 (32%)
DnaJ 7..65 CDD:278647 33/61 (54%)
DnaJ_C 112..336 CDD:199909 69/243 (28%)
DnaJ_zf 140..206 CDD:199908 25/71 (35%)
SPBC1347.05cNP_596697.3 DnaJ 20..389 CDD:223560 122/377 (32%)
DnaJ 24..86 CDD:278647 33/62 (53%)
DnaJ_zf 168..237 CDD:199908 25/71 (35%)
DnaJ_C 236..376 CDD:199909 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.