DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and psi1

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_588477.1 Gene:psi1 PomBaseID:SPCC830.07c Length:379 Species:Schizosaccharomyces pombe

Alignment Length:439 Identity:132/440 (30%)
Similarity:184/440 (42%) Gaps:166/440 (38%)


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            ||.:|..||.|.|:|.|:..||||||||||||||||||||..:|||.||.|||||||..:|::||
pombe     1 MVADTKLYDCLEVRPEASEAELKKAYRKLALKYHPDKNPNGEKKFKEISLAYEVLSDPQRRKLYD 65

  Fly    66 ----------------EGGEAA-----------------IKKGGADSGDF---RNPMDFFEKFFG 94
                            |||..|                 ...||.....|   .:|.|.||:.||
pombe    66 QYGITEGNAAPPPPGAEGGPGAGFGGFPGAGPGGARTFHFNMGGPGGAQFFSASDPNDIFERVFG 130

  Fly    95 ---AGFGGSGGGR-----------------RRERRG----------------------------- 110
               ||.||.|||.                 .|.|.|                             
pombe   131 HAFAGGGGMGGGMGGMGGMDDDMDMDGGFGTRTRGGGMPGGFANMFGGGGAGPHARRSHPSFGGS 195

  Fly   111 ---------KDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVET 166
                     :.:...::|.||:|:.|.|:|:::.:::|                           
pombe   196 RPSQPPAQNEVITRPLNVSLEDLFTGCTKKMKISRHII--------------------------- 233

  Fly   167 RVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFT 231
                                              :.|| ::|:..::||:.::.|.:.|.||.|.
pombe   234 ----------------------------------DASG-QSVKADRILEIKVKPGWKAGTKIKFA 263

  Fly   232 GEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVS-- 294
            ||||.:|:....||..:|.||.|..|..:|.||.|::.|.|.|||.||.:.:.|:|.:.|.||  
pombe   264 GEGDEKPDGTVQDIQFVLAEKPHPVFTRSGDDLRMQVELSLKEALLGFSKQISTIDGKKLKVSSS 328

  Fly   295 --TQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPS 341
              ||||    :|:|  ....|||:.|||.::|.:||:.:|.||..:.|:
pombe   329 LPTQPG----YEIT--YPGFGMPLPKNPSQRGNMIIECKVKFPTELTPA 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 131/439 (30%)
DnaJ 7..65 CDD:278647 40/58 (69%)
DnaJ_C 112..336 CDD:199909 64/228 (28%)
DnaJ_zf 140..206 CDD:199908 2/66 (3%)
psi1NP_588477.1 DnaJ 2..379 CDD:223560 131/439 (30%)
DnaJ 7..65 CDD:278647 40/58 (69%)
DnaJ_C 207..368 CDD:199909 64/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.970

Return to query results.
Submit another query.