DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and CG30156

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001260752.1 Gene:CG30156 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster

Alignment Length:141 Identity:47/142 (33%)
Similarity:68/142 (48%) Gaps:26/142 (18%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEG--EKFKAISQAYEVLSDADKRQVYDEGGE 69
            :|::|.:..:||..|:|:||.||||:.|||||.:.|  :.|:.||:|.:.|:|..||..|:    
  Fly    97 HYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYN---- 157

  Fly    70 AAIKKGG------ADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGA 128
            .|...|.      :...|:|...:|.|    |.....|...||..||   .:|...|.:.||   
  Fly   158 IATAVGDCHDQDPSQYKDYRGESEFNE----ANGNDLGAAFRRPYRG---ANQRMPQRQSLY--- 212

  Fly   129 TRKLQLQKNVI 139
                |.|:.||
  Fly   213 ----QTQQLVI 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 47/142 (33%)
DnaJ 7..65 CDD:278647 27/60 (45%)
DnaJ_C 112..336 CDD:199909 8/29 (28%)
DnaJ_zf 140..206 CDD:199908 47/142 (33%)
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 27/60 (45%)
DUF1977 237..334 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.