DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnj-7

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_509209.1 Gene:dnj-7 WormBaseID:WBGene00001025 Length:491 Species:Caenorhabditis elegans

Alignment Length:109 Identity:49/110 (45%)
Similarity:62/110 (56%) Gaps:18/110 (16%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKA------ISQAYEVLSDADKRQVYD 65
            ||.|||||.||:..|:.|||||||.|:|||...:|.||.||      |:.|.|||.|.:||:.:|
 Worm   380 YYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKKKAEKKFIDIAAAKEVLQDEEKRRQFD 444

  Fly    66 EGGE----AAIKKGGADSGDFRN--PMDFFEKFFGAGFGGSGGG 103
            :|.:    .|.::||...|.|.:  |..|..      |||.|||
 Worm   445 QGVDPLDPEAQRQGGGHHGGFGHGFPHGFHH------FGGGGGG 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 49/110 (45%)
DnaJ 7..65 CDD:278647 34/64 (53%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
dnj-7NP_509209.1 TPR_11 29..91 CDD:290150
TPR repeat 29..54 CDD:276809
TPR repeat 59..89 CDD:276809
TPR_1 60..93 CDD:278916
TPR_11 61..124 CDD:290150
TPR 77..360 CDD:223533
TPR repeat 94..121 CDD:276809
TPR repeat 140..168 CDD:276809
TPR repeat 173..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 324..354 CDD:276809
TPR_1 325..358 CDD:278916
DnaJ 377..>445 CDD:223560 35/65 (54%)
DnaJ 379..444 CDD:278647 34/64 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.