DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnj-14

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001257015.1 Gene:dnj-14 WormBaseID:WBGene00001032 Length:217 Species:Caenorhabditis elegans

Alignment Length:70 Identity:41/71 (58%)
Similarity:53/71 (75%) Gaps:4/71 (6%)


  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKN----PNEGEKFKAISQAYEVLSDADKRQVYDEGG 68
            |::||::.|||.||:|||||||||:||||||    |.:.|.||.|:.|..|||:.:||:||||.|
 Worm    40 YNVLGIQKNATDDEIKKAYRKLALRYHPDKNLDGDPEKTEMFKEINYANAVLSNPNKRRVYDEMG 104

  Fly    69 EAAIK 73
            |..:|
 Worm   105 ETGLK 109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 41/71 (58%)
DnaJ 7..65 CDD:278647 36/61 (59%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
dnj-14NP_001257015.1 DnaJ 39..101 CDD:278647 36/61 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.