DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnj-12

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_493570.1 Gene:dnj-12 WormBaseID:WBGene00001030 Length:402 Species:Caenorhabditis elegans

Alignment Length:411 Identity:195/412 (47%)
Similarity:259/412 (63%) Gaps:17/412 (4%)


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            |||||||||:|||||:|:.:||||||||:|||:||||||:..|:||.||||||||||..|||:||
 Worm     1 MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYD 65

  Fly    66 EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATR 130
            :|||.|::.||.....|.||.|.|:.|    |||.|.|.|.|||.|..||.:.|.|:.||.|.|:
 Worm    66 QGGEEALQGGGGGGEGFHNPFDVFDMF----FGGGGRGGRGERRVKPTVHNLRVTLDTLYKGVTK 126

  Fly   131 KLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQE 195
            ||::.:...|..|:|.||.:||.::|..|||.|::.||.::.| ::|.::..|..|:|.|.|..|
 Worm   127 KLKISRTATCKGCKGLGGNEGSAKECSDCRGRGIKVRVIRMGP-MVQQMQSHCDSCNGEGSTFLE 190

  Fly   196 KDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHE-PESQPGDIIILLDEKEHSTFAH 259
            |||||.|:|:|.|:|.:::||.|..||:||:|.||.|:||.. ...:|||.:::|||.||..|..
 Worm   191 KDRCKKCNGKKQVKEDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVR 255

  Fly   260 AGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKG 324
            .|.:|:::..:.|.||||||.|.:.|||.|.:.....|||||.|...|.|..||||:.:...:||
 Worm   256 KGDNLIIQHNIDLSEALCGFVRTISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKG 320

  Fly   325 TLIIQFEVIFPEVINPSVVPTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQRRQQHQRMAYDEDD- 388
            .|::||:|.||:.|||.....|...||...|..|..|||...|.:.||    |..:|...:.|| 
 Worm   321 DLLVQFDVKFPDKINPDAAKKLADLLPGKREEIIDEDAEVVELTELDP----QASRRNFAERDDF 381

  Fly   389 ------GGYQDGPRVQQCTSS 403
                  ||:..||:..||..|
 Worm   382 EGHGGFGGHGHGPQGVQCQQS 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 191/404 (47%)
DnaJ 7..65 CDD:278647 43/58 (74%)
DnaJ_C 112..336 CDD:199909 98/225 (44%)
DnaJ_zf 140..206 CDD:199908 29/66 (44%)
dnj-12NP_493570.1 PTZ00037 2..401 CDD:240236 193/408 (47%)
DnaJ 7..65 CDD:278647 43/58 (74%)
DnaJ_zf 136..201 CDD:199908 29/66 (44%)
DnaJ_C 200..334 CDD:199909 59/134 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139709345
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H23110
Inparanoid 1 1.050 380 1.000 Inparanoid score I1183
Isobase 1 0.950 0 Normalized mean entropy S577
OMA 1 1.010
OrthoDB 1 1.010 D1012379at2759
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 1 1.000 T475747
orthoMCL 1 0.900 OOG5_126883
Panther 1 1.100 LDO PTHR43888
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R684
TreeFam 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.