DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnj-27

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001040704.1 Gene:dnj-27 WormBaseID:WBGene00001045 Length:788 Species:Caenorhabditis elegans

Alignment Length:421 Identity:88/422 (21%)
Similarity:156/422 (37%) Gaps:142/422 (34%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN---PNEGEKFKAISQAYEVLSDADKRQVYDEGG 68
            ||::|||:.:|....::||::|||:|.|||:|   ||..::|..|::|||||.|.:.|:.||:.|
 Worm    21 YYELLGVERDADDRTIRKAFKKLAIKKHPDRNTDDPNAHDEFVKINKAYEVLKDENLRKKYDQFG 85

  Fly    69 EAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQ 133
            |..::.|.....::::     .:|:...||               ::....::..|.....:::.
 Worm    86 EKGLEDGFQGGNNYQS-----WQFYNDNFG---------------IYDDDQEIVTLNRADFQRMV 130

  Fly   134 LQKNVI---------CDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGT 189
            ...|.|         |..|                         .|:||    ...:..|:..||
 Worm   131 SDSNEIWFINFYSTYCSHC-------------------------HQLAP----TWRKFAREIEGT 166

  Fly   190 ---GETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVF--TGE--GDHEPESQPGDIII 247
               |..        ||:....:.:.:.:..:        ..:||  |||  ..|.      |:.:
 Worm   167 IRVGAV--------NCAEDPQLCQSQRVNAY--------PSLVFYPTGEFYQGHR------DVEL 209

  Fly   248 LLD---EKEHSTFAHAGQDLMMKMP--------LQLVEALCGFQRIVKTLDDRDLIVSTQPGEVI 301
            ::|   ::..|...|...:....:.        |..|..:||...|       |.:.||     .
 Worm   210 MVDFAIQRLKSEVLHLNSENWKALSEDWEPYNRLPWVVDMCGGDHI-------DCLSST-----T 262

  Fly   302 RHEMTK------------CIAEEGMPIFKNPMEKGTL-----------IIQFEVIFPEVINPSVV 343
            |.:::.            |.|||.:....||:..|.:           .|..|.:..:.|:.||:
 Worm   263 RRKLSSMLDGLANVATIDCNAEEALCSKFNPITSGVMWFPARKLVKKSQINIESMDAQEISKSVI 327

  Fly   344 PTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQ 374
            ..|.:.      .||.:::.|.:||..||.:
 Worm   328 QYLDEL------EDISVESLQRLLEGNDPDE 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 88/422 (21%)
DnaJ 7..65 CDD:278647 28/61 (46%)
DnaJ_C 112..336 CDD:199909 42/274 (15%)
DnaJ_zf 140..206 CDD:199908 11/69 (16%)
dnj-27NP_001040704.1 DnaJ 18..>150 CDD:223560 40/174 (23%)
DnaJ 20..82 CDD:278647 28/61 (46%)
PDI_a_ERdj5_N 116..214 CDD:239301 22/149 (15%)
Thioredoxin_like 222..>312 CDD:294274 17/102 (17%)
ER_PDI_fam 438..750 CDD:273457
PDI_a_ERdj5_C 438..543 CDD:239302
PDI_a_ERdj5_C 549..664 CDD:239302
PDI_a_ERdj5_C 670..773 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.