DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnj-28

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_491084.1 Gene:dnj-28 WormBaseID:WBGene00001046 Length:494 Species:Caenorhabditis elegans

Alignment Length:115 Identity:49/116 (42%)
Similarity:63/116 (54%) Gaps:13/116 (11%)


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKA------ISQAYEVLSDAD 59
            :|.:..||.||||:.||...|:.|||||:|.|:|||...:|.||.||      |:.|.||||:.:
 Worm   375 LVGKRDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEE 439

  Fly    60 KRQVYDEGGEAAIKK------GGADSGDFRNPMDFFEKFFGAGFGGSGGG 103
            ||:.:|.|.:....:      ||..|..|.| ...|..|.|.|.||.|||
 Worm   440 KRRAFDNGQDPLDSEAGRGGGGGGGSHGFHN-FHGFNPFGGGGGGGRGGG 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 49/115 (43%)
DnaJ 7..65 CDD:278647 32/64 (50%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
dnj-28NP_491084.1 TPR_11 23..89 CDD:290150
TPR repeat 28..52 CDD:276809
TPR_1 <31..56 CDD:278916
TPR repeat 57..87 CDD:276809
TPR_9 78..136 CDD:290108
TPR repeat 92..116 CDD:276809
TPR_11 174..240 CDD:290150
TPR repeat 175..203 CDD:276809
TPR repeat 208..238 CDD:276809
TPR repeat 291..321 CDD:276809
TPR_11 294..356 CDD:290150
TPR repeat 326..352 CDD:276809
DnaJ 378..>445 CDD:223560 32/67 (48%)
DnaJ 380..445 CDD:278647 32/65 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.