DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajb4

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001096404.1 Gene:dnajb4 XenbaseID:XB-GENE-1007708 Length:357 Species:Xenopus tropicalis

Alignment Length:371 Identity:110/372 (30%)
Similarity:160/372 (43%) Gaps:120/372 (32%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.:||::..|:.|::||||||.|||:|||||  .:..||||.|::|||||||..||:|||:.||
 Frog     5 YYSVLGIEKGASEDDIKKAYRKQALKWHPDKNKSAHAEEKFKEIAEAYEVLSDPKKREVYDQFGE 69

  Fly    70 AAIKKG-GADSGDFRNPMDFFEKF-------FGAGFGGSG-----------GGRRRE-------- 107
            ..:|.| ||..|...|   |...|       |.|.|||:.           |||..|        
 Frog    70 EGLKGGSGAPDGHGGN---FHYTFHGDPHATFAAFFGGANPFEIFFGRRMPGGRDDEDMELDGDP 131

  Fly   108 -----------------------RRGKD--VVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRG 147
                                   ||.:|  ::|.:.|.|||:|.|.|:::::.:..:        
 Frog   132 FSSFTSFNMNGFPREKNQVGNQFRRKQDPPIIHDLRVSLEEIYTGCTKRMRISRKRL-------- 188

  Fly   148 GKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERK 212
                                                                 |..||....|.|
 Frog   189 -----------------------------------------------------NPDGRSVRTEDK 200

  Fly   213 VLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALC 277
            :|.:.|:||.::|.||.|..|||..|.:.|.||:.::.:|.|:.|...|.:::..:.:.|.||||
 Frog   201 ILTIEIKKGWKEGTKITFPREGDEAPMTIPADIVFVVKDKPHTHFKRDGSNIVCPVRVSLREALC 265

  Fly   278 GFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEK 323
            |....|.|||.|.:.::.  .::|:..|.:.|...|:|..|.|..|
 Frog   266 GCSINVPTLDGRSIPMTI--NDIIKPGMRRRIIGYGLPFPKKPRTK 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 110/372 (30%)
DnaJ 7..65 CDD:278647 36/60 (60%)
DnaJ_C 112..336 CDD:199909 52/215 (24%)
DnaJ_zf 140..206 CDD:199908 3/66 (5%)
dnajb4NP_001096404.1 DnaJ_bact 4..307 CDD:274090 109/368 (30%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 160..304 CDD:199909 48/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.