DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Ghsr

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_114464.1 Gene:Ghsr RGDID:621397 Length:364 Species:Rattus norvegicus

Alignment Length:371 Identity:130/372 (35%)
Similarity:177/372 (48%) Gaps:56/372 (15%)


  Fly    48 ANPSESPEMLLLKNDKFLTHVAHLLNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTA--- 109
            |.|||.||.                |:|.:    |....:..|      ||..||.|.|..|   
  Rat     4 ATPSEEPEP----------------NVTLD----LDWDASPGN------DSLPDELLPLFPAPLL 42

  Fly   110 ---LTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYP 171
               ...|.|| ||.|:.|||:|.:|:||...:.|.||.||.::|.|||::.:. :|.:|..||..
  Rat    43 AGVTATCVAL-FVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLC-MPLDLVRLWQY 105

  Fly   172 DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAA 236
            ..:.|.|.:|.:...:||....||||||||.:||||.|||.|.|...:....|....|..||..|
  Rat   106 RPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVA 170

  Fly   237 FLLALPQAMQFSVVYQNEGYSCTMENDFYAHVFAV-SGF---------IFFGGPMTAICVLYVLI 291
            |..|.|..:...|.::| |......|:..|..||| ||.         :||..|:..:.|||.||
  Rat   171 FCSAGPIFVLVGVEHEN-GTDPRDTNECRATEFAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLI 234

  Fly   292 GVKLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIG 356
            |.||.|.|...::.....|.|     ..:.::||..|..||.|||.|||..|.:........::.
  Rat   235 GRKLWRRRGDAAVGASLRDQN-----HKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLE 294

  Fly   357 ISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREA-FKI 401
            |::  .:.|..::.:   ||::||..|||:||||||.|:|.| ||:
  Rat   295 IAQ--ISQYCNLVSF---VLFYLSAAINPILYNIMSKKYRVAVFKL 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 54/128 (42%)
7tm_1 124..388 CDD:278431 97/274 (35%)
GhsrNP_114464.1 7tm_4 53..>171 CDD:304433 50/119 (42%)
7tm_1 59..321 CDD:278431 97/274 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66662365
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.