DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and ghsra

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001139744.1 Gene:ghsra ZFINID:ZDB-GENE-070912-238 Length:360 Species:Danio rerio

Alignment Length:345 Identity:117/346 (34%)
Similarity:172/346 (50%) Gaps:49/346 (14%)


  Fly    90 NASTMAADSPVD-ESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSD 153
            ||:....:.||: ..:.:.|.:||...|.|..||.|||:|.:|:::...|.|.||.||.::|.||
Zfish    19 NATYWGIEQPVNIFPIPVLTGVTVTCVLFFFVGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSD 83

  Fly   154 LILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHT 218
            |::.:. :|.:||.:|....:.|.:.:|.:...:||....:|:|.|||.:||||.|||.|.|...
Zfish    84 LLIFLC-MPLDLYRIWRYRPWNFGNILCKLFQFVSECCTYSTILNITALSVERYFAICFPLRAKV 147

  Fly   219 MSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTMENDFYAHVFAV-SGF-------- 274
            :....|....|..:|:.:|..|.|..:...|.::| |.:....|:..|..:|: ||.        
Zfish   148 VVTKGRVRGVILVLWIVSFFSAGPVFVLVGVEHEN-GTNSWDTNECKATEYAIRSGLLTIMVWVS 211

  Fly   275 -IFFGGPMTAICVLYVLIGVKL-KRSRLLQSLPRRTFDANRGLNAQGR------VIRMLVAVAVA 331
             |||..|:..:.|||.|||.|| ||.|           ...|.||..|      .::||..|..|
Zfish   212 SIFFFLPVFCLTVLYSLIGRKLWKRKR-----------ETIGENASSRDKSNRQTVKMLAVVVFA 265

  Fly   332 FFLCWAPFHAQRLM----AVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMS 392
            |.|||.|||..|.:    ...|..:::|      .:.|..::.:   ||::||..|||:||||||
Zfish   266 FVLCWLPFHVGRYLISKSTEMGSPVMSI------ISHYCNLISF---VLFYLSAAINPILYNIMS 321

  Fly   393 HKFREAFKITLTRQFGLARN 412
            .|:|.|    ..:.||| ||
Zfish   322 KKYRMA----ACKLFGL-RN 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 46/128 (36%)
7tm_1 124..388 CDD:278431 93/285 (33%)
ghsraNP_001139744.1 7tm_4 49..333 CDD:304433 104/310 (34%)
7tm_1 54..317 CDD:278431 93/285 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66679657
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.