DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Nmur1

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_017452121.1 Gene:Nmur1 RGDID:619867 Length:439 Species:Rattus norvegicus

Alignment Length:439 Identity:148/440 (34%)
Similarity:213/440 (48%) Gaps:79/440 (18%)


  Fly    44 SSTMANPSESPEMLLLKNDKFLTHV-AHLLNITTENLS-NLLGSTNGTNASTMAADSPVDESLTL 106
            |....:|:.|..:|...:.:|..|. ...||:|.|:|. ..||...                  :
  Rat    25 SQLRLSPNASTGLLSCNDSEFKEHFDLEDLNLTHEDLRLKYLGPQQ------------------V 71

  Fly   107 RTALTVC--YALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLW 169
            :..|.:|  |.||||.|.|||.:||.||.|...|||.||||||:||||||::|:.|:|.|||.:.
  Rat    72 KQFLPICVTYLLIFVVGTLGNGLTCTVILRQKAMHTPTNFYLFSLAVSDLLVLLVGLPLELYEMQ 136

  Fly   170 YPDMYPFT--DAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAI 232
            :  .|||.  ...|....:|.|....|:||.:||.:||||:|:.||.:..::...:...:.:.||
  Rat   137 H--NYPFQLGAGGCYFRILLLETVCLASVLNVTALSVERYVAVVHPLQAKSVMTRTHVRRMLGAI 199

  Fly   233 WLAAFLLALPQAM--QFSVVY------QNEGYSCTMEND--FYAHVFAVSGFIFFGGPMTAICVL 287
            |:.|.|.:||...  ..|.:|      ..:..:||:...  ||..|...:..:||..||..|.||
  Rat   200 WVFAILFSLPNTSLHGLSPLYVPCRGPVPDSVTCTLVRPQFFYKLVIQTTILLFFCLPMVTISVL 264

  Fly   288 YVLIGVKLKRSR-LLQSLPRRTFDA------NRGLNAQGR----VIRMLVAVAVAFFLCWAPFHA 341
            |:|||::|:|.| |||...:....|      :|.:..:.|    |.:||:|:.:.|..||.||||
  Rat   265 YLLIGLRLRRERILLQEEVKGRISAAARQASHRSIQLRDRERRQVTKMLIALVIVFGTCWVPFHA 329

  Fly   342 QRLM------AVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFK 400
            .|||      ...||.|.            |:.:...|||..:|.:..||:|||:||.:|||:|:
  Rat   330 DRLMWSMVSHWTDGLRLA------------FQSVHLASGVFLYLGSAANPVLYNLMSTRFRESFR 382

  Fly   401 ITLTRQFGL-ARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNA 448
            .||    || .|..|..|.:|..|::         :||...|...:.|:
  Rat   383 ETL----GLGTRCCHRHQPRHDSHSH---------LRLTTVSTLCDRNS 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 59/130 (45%)
7tm_1 124..388 CDD:278431 105/293 (36%)
Nmur1XP_017452121.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66658118
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T131236
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.