DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Nmur2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_071611.3 Gene:Nmur2 RGDID:621155 Length:395 Species:Rattus norvegicus

Alignment Length:427 Identity:127/428 (30%)
Similarity:201/428 (47%) Gaps:73/428 (17%)


  Fly    72 LNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNN 136
            ||.|.|.|::|.|              |....|:|  .::|.|||||:.||:|||:.|:||.|:.
  Rat    18 LNSTEEYLAHLCG--------------PKRSDLSL--PVSVAYALIFLVGVMGNLLVCMVIVRHQ 66

  Fly   137 FMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITA 201
            .:.|.||:|||:||||||::|:.|:|.|:|.:|:...:.|....|...:.|.|....|::|::|.
  Rat    67 TLKTPTNYYLFSLAVSDLLVLLLGMPLEIYEMWHNYPFLFGPVGCYFKTALFETVCFASILSVTT 131

  Fly   202 FTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQN--EGYS------C 258
            .:||||:||.||||....|...||::.:..:|..:.:.:||......:.:|:  .|.|      |
  Rat   132 VSVERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIKFQHFPNGSSVPGSATC 196

  Fly   259 TMENDFYAH--VFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRV 321
            |:....:.:  :...:.|:|:..|||.|.|||.|:|::|||.   :||.......|....::..|
  Rat   197 TVTKPMWVYNLIIQATSFLFYILPMTLISVLYYLMGLRLKRD---ESLEANKVAVNIHRPSRKSV 258

  Fly   322 IRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPL 386
            .:||..:.:.|.:||.|||..||...:      :....::....|.::...|||.::||:.:||:
  Rat   259 TKMLFVLVLVFAICWTPFHVDRLFFSF------VEEWTESLAAVFNLIHVVSGVFFYLSSAVNPI 317

  Fly   387 LYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEP 451
            :||::|.:||.||:..::.........|..|.                                |
  Rat   318 IYNLLSRRFRAAFRNVVSPTCKWCHPRHRPQG--------------------------------P 350

  Fly   452 YGSYRVVQFRC------RDANHQLSLQDSIRTTTTTT 482
            .....:....|      .||..|...|.||..|..||
  Rat   351 PAQKIIFLTECHLVELTEDAGPQFPGQSSIHNTNLTT 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 54/128 (42%)
7tm_1 124..388 CDD:278431 89/274 (32%)
Nmur2NP_071611.3 7tm_4 48..333 CDD:304433 99/294 (34%)
7tm_1 54..319 CDD:278431 89/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66661099
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T131236
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.