DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and nmur1b

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_698473.4 Gene:nmur1b ZFINID:ZDB-GENE-131121-154 Length:404 Species:Danio rerio

Alignment Length:390 Identity:135/391 (35%)
Similarity:197/391 (50%) Gaps:75/391 (19%)


  Fly   110 LTVC--YALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPD 172
            |.:|  |.||||.||:||::|||||:|:..|.|.||:|||:||:|||::|:.|:|.|||.||  .
Zfish    60 LPICVTYLLIFVVGVVGNILTCIVITRHRIMRTTTNYYLFSLAISDLLVLLLGLPLELYELW--S 122

  Fly   173 MYPFTDAM--CIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLA 235
            .|||...:  |...:.|.|....|:||.:||.:.|||.||.||.....::..:.|.:.|..:|..
Zfish   123 NYPFLFGISGCYFKTCLFETVCFASVLNVTALSAERYRAIIHPLHTKHVATSAHAKRVILVLWAV 187

  Fly   236 AFLLALPQAM---------QFSVVYQNEGYSCTMEND--FYAHVFAVSGFIFFGGPMTAICVLYV 289
            :.|.|||...         :|.:.:...|. ||:.:|  .|..:..|:..:||..||..|.||||
Zfish   188 SLLCALPNTSIHGVEMLKPRFGLTFPESGV-CTVVHDRWIYNLLVQVTALLFFILPMLTISVLYV 251

  Fly   290 LIGVKLKRSRLLQSLPRRTFDANRGLNAQG--------RVIRMLVAVAVAFFLCWAPFHAQRLMA 346
            |||::|.|.       |..||:...||..|        :|.:||.|:.:.|.:||||||..|:|.
Zfish   252 LIGLQLHRE-------RECFDSKIVLNQDGVNQRARHRQVTKMLCALVIVFGICWAPFHIDRVMW 309

  Fly   347 VYGLNLINIGISRDAFNDY-------FRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLT 404
            .|             .:|:       |..:...|||.::||:.:||:|||:||.:|||.|:..:.
Zfish   310 SY-------------IDDWTAENHHIFEYVHLLSGVFFYLSSVVNPILYNLMSSRFREMFREVVC 361

  Fly   405 RQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEPYGSYRVVQFRCRDANHQL 469
                        |..|.|.:.|.:..::    :..||.|.:|..     |:. |:|..|:..|.|
Zfish   362 ------------QKDHRQLSMSRVTLRS----VVSASFSASNTV-----SFS-VKFNPRELPHTL 404

  Fly   470  469
            Zfish   405  404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 59/130 (45%)
7tm_1 124..388 CDD:278431 104/292 (36%)
nmur1bXP_698473.4 7tm_1 76..345 CDD:278431 104/292 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66673244
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.