DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and NMUR2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_064552.3 Gene:NMUR2 HGNCID:16454 Length:415 Species:Homo sapiens

Alignment Length:443 Identity:133/444 (30%)
Similarity:212/444 (48%) Gaps:78/444 (18%)


  Fly    62 DKFLTHVAHLLNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCYALIFVAGVLGNL 126
            |.|..|    ||.|.|.|:.|.|              |......|  .::|.|..|||.||:||:
Human    20 DPFQKH----LNSTEEYLAFLCG--------------PRRSHFFL--PVSVVYVPIFVVGVIGNV 64

  Fly   127 ITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLW--YPDMYPFTDAMCIMGSVLSE 189
            :.|:||.::..|.|.||:|||:||||||::|:.|:|.|:|.:|  ||  :.|....|...:.|.|
Human    65 LVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYP--FLFGPVGCYFKTALFE 127

  Fly   190 MAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNE 254
            ....|::|:||..:||||:||.||||....|...||::.:..:|..:.|.:||......:.:.  
Human   128 TVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLPNTSIHGIKFH-- 190

  Fly   255 GY-----------SCTMEND--FYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPR 306
             |           :||:...  .|..:..|:.|:|:..|||.|.|||.|:.::||:.:   ||..
Human   191 -YFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMALRLKKDK---SLEA 251

  Fly   307 RTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDY 371
            ...:||.....:..|.:||..:.:.|.:||||||..||...:      :....::....|.::..
Human   252 DEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSF------VEEWSESLAAVFNLVHV 310

  Fly   372 TSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMR 436
            .|||.::||:.:||::||::|.:|:.||:..:        :..|:| .|.||:          .:
Human   311 VSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVI--------SSFHKQ-WHSQHD----------PQ 356

  Fly   437 LQPASCSV------NNNALEPYGSYRVVQFRCRDANHQLSLQDSIRTTTTTTT 483
            |.||..::      .....|..|.    ||.|:.:.|...|..::.:...:.|
Human   357 LPPAQRNIFLTECHFVELTEDIGP----QFPCQSSMHNSHLPAALSSEQMSRT 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 56/130 (43%)
7tm_1 124..388 CDD:278431 92/279 (33%)
NMUR2NP_064552.3 7tm_1 62..327 CDD:278431 92/279 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66669754
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T130221
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.