DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and nmur1a

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_021325138.1 Gene:nmur1a ZFINID:ZDB-GENE-081104-220 Length:428 Species:Danio rerio

Alignment Length:435 Identity:144/436 (33%)
Similarity:212/436 (49%) Gaps:105/436 (24%)


  Fly    28 PSPNQSPSIGVGIGIASSTMANPSESPEML--LLKNDKFLTHVAHLLNIT-----------TENL 79
            |.||           .|||   .|.:|:.:  ||.|    |.||  ||:|           .|.|
Zfish     3 PKPN-----------CSST---DSSTPKCIQDLLCN----TSVA--LNLTEMEIEDFCLDQDEYL 47

  Fly    80 SNLLGSTNGTNASTMAADSPVDESLTLRTALTVC--YALIFVAGVLGNLITCIVISRNNFMHTAT 142
            ...||...          |||        .|.||  |.|||:.|.:||::|||||::|..|.|.|
Zfish    48 EKYLGPRR----------SPV--------FLPVCLTYLLIFLVGAVGNILTCIVIAKNKVMRTPT 94

  Fly   143 NFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFT--DAMCIMGSVLSEMAANATVLTITAFTVE 205
            |||||:||:|||::|:.|:|.|||.:|  ..|||.  ...|...::|.|....|::|.:||.:||
Zfish    95 NFYLFSLAISDLLVLLLGMPLELYEMW--SNYPFLLGKGGCYFKTLLFETVCFASILNVTALSVE 157

  Fly   206 RYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVV-----------YQNEGYSCT 259
            ||||:.||.|...:...:.|.:.|.::|..:.|.|:|..:...:.           ...:..:|.
Zfish   158 RYIAVIHPLRAKYVVTRTHAKRLILSVWSISVLCAIPNTILHGIFTLPPPKGKAAGVMLDSATCM 222

  Fly   260 MEND--FYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQG--- 319
            :...  .|..:..::..:||..||..|.|||:|||::|||.::||.|..:   |:.||::..   
Zfish   223 LVKPRWMYNLIIQITTLLFFLLPMLTISVLYLLIGMQLKREKMLQVLEAK---ASSGLDSSSNVR 284

  Fly   320 ---------RVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFN-DYFRILDYT-- 372
                     :|.:||..:.|.|.:||||||..|||       .:....:|:.: :.|.:.:|.  
Zfish   285 SQQQKTRRQQVTKMLFVLVVMFGICWAPFHTDRLM-------WSFMDQKDSEHIEIFEVYEYVHV 342

  Fly   373 -SGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQ 416
             |||.::||:.|||:|||:||.:|||.||..:.         ||:
Zfish   343 ISGVFFYLSSAINPVLYNLMSTRFREMFKEVMC---------HHK 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 57/130 (44%)
7tm_1 124..388 CDD:278431 101/295 (34%)
nmur1aXP_021325138.1 7tmA_NMU-R1 60..370 CDD:320480 116/322 (36%)
TM helix 1 60..87 CDD:320480 15/27 (56%)
TM helix 2 94..120 CDD:320480 17/26 (65%)
TM helix 3 133..163 CDD:320480 13/30 (43%)
TM helix 4 175..197 CDD:320480 6/22 (27%)
TM helix 5 230..259 CDD:320480 12/29 (41%)
TM helix 6 290..320 CDD:320480 14/37 (38%)
TM helix 7 338..363 CDD:320480 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66665457
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.