| Sequence 1: | NP_731790.1 | Gene: | PK2-R1 / 41639 | FlyBaseID: | FBgn0038140 | Length: | 660 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287439.1 | Gene: | ETHR / 42523 | FlyBaseID: | FBgn0038874 | Length: | 471 | Species: | Drosophila melanogaster | 
| Alignment Length: | 396 | Identity: | 109/396 - (27%) | 
|---|---|---|---|
| Similarity: | 179/396 - (45%) | Gaps: | 62/396 - (15%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   108 TALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNL-WYP 171 
  Fly   172 DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAA 236 
  Fly   237 FLLALP--QAMQFSVVYQNEGYS---CTME--NDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVK 294 
  Fly   295 L--KRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLN--LINI 355 
  Fly   356 GISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQH 420 
  Fly   421 HQHNYSALLRQNGSMRLQPASCSVNNNALEPYGSYRVVQFRCRDANHQLSLQDSIRTTTTTTTIN 485 
  Fly   486 SNSMAA 491 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| PK2-R1 | NP_731790.1 | 7tm_4 | 114..>242 | CDD:304433 | 42/128 (33%) | 
| 7tm_1 | 124..388 | CDD:278431 | 78/275 (28%) | ||
| ETHR | NP_001287439.1 | 7tm_4 | 18..>143 | CDD:304433 | 41/124 (33%) | 
| 7tm_1 | 27..294 | CDD:278431 | 78/275 (28%) | ||
| 7tm_4 | <102..307 | CDD:304433 | 65/239 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45445872 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24243 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5416 | 
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.970 | |||||