DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and ETHR

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001287439.1 Gene:ETHR FlyBaseID:FBgn0038874 Length:471 Species:Drosophila melanogaster

Alignment Length:394 Identity:109/395 (28%)
Similarity:182/395 (46%) Gaps:62/395 (16%)


  Fly   108 TALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNL-WYP 171
            ||:..| .:|.:.||:||::..|||.:...|..:||.:|.||:::||::|:...|..|..: ..|
  Fly    12 TAMFFC-IVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTVLVEVNTRP 75

  Fly   172 DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAA 236
            :.:.....||.....:....|:|:||||.|.:.|||.|||.|.:...:....|||......|..|
  Fly    76 ETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIA 140

  Fly   237 FLLALP--QAMQFSVVYQNEGYS---CTME--NDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVK 294
            .|...|  ...::.:....:|.|   |..:  :|:....|.::..:||..|...:.|||.:|...
  Fly   141 ALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVVLYGIIARN 205

  Fly   295 L--KRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLN--LINI 355
            |  .|:.:|::.|.:   ....|.|:.:|:.||.||.::||:|..||....|..:...:  |.::
  Fly   206 LVSNRAAMLRARPTK---PELSLKARKQVVLMLGAVVLSFFVCLLPFRVLTLWIILSTDQTLHDL 267

  Fly   356 GISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFK-------------ITLTRQ- 406
            |:.|     |:.:| |...::.:|::.:||:|||:||.|||..||             :||.|: 
  Fly   268 GLVR-----YYSLL-YFCRIMLYLNSAMNPILYNLMSTKFRRGFKRLCQDAGRLLLELVTLGRRK 326

  Fly   407 --------------FGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCS--VNNNALE----- 450
                          .|...|.:...|.......|::|.::.:.|     ||  ::...|:     
  Fly   327 EDSSRGRRGTLSLGMGTNTNTNTNSSNATGATSSSILSRSSNRR-----CSEDISRTRLKIEMQM 386

  Fly   451 PYGS 454
            |.||
  Fly   387 PCGS 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 42/129 (33%)
7tm_1 124..388 CDD:278431 79/276 (29%)
ETHRNP_001287439.1 7tm_4 18..>143 CDD:304433 42/125 (34%)
7tm_1 27..294 CDD:278431 79/276 (29%)
7tm_4 <102..307 CDD:304433 65/214 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C68214552
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24243
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
33.060

Return to query results.
Submit another query.