DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and PK1-R

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001014620.1 Gene:PK1-R FlyBaseID:FBgn0038201 Length:430 Species:Drosophila melanogaster

Alignment Length:374 Identity:180/375 (48%)
Similarity:225/375 (60%) Gaps:66/375 (18%)


  Fly    90 NASTMAAD-SPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSD 153
            :|..|:.| .|..:.|.:...:||.|:|||:.||:||:.|||||.:|..||||||:|||:||:||
  Fly     2 SAGNMSHDLGPPRDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYYLFSLAISD 66

  Fly   154 LILLVSGIPQELYNLW--YPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQ 216
            .:||:||:|||:..:|  ||  |.|.:.:||...:|:|.:|||||||||||||||||||||||..
  Fly    67 FLLLLSGVPQEVSYIWSKYP--YVFGEYICIGRGLLAETSANATVLTITAFTVERYIAICHPFLG 129

  Fly   217 HTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTMENDFYAHVFAVSGFIFFGGPM 281
            ..||||||||:.|..:|:.|.:.|:|||.||.:.:.:....|.:......|.|.:|.||||..||
  Fly   130 QAMSKLSRAIRIIVLVWIMAIVTAIPQAAQFGIEHYSGVEQCGIVRVIVKHSFQLSTFIFFLAPM 194

  Fly   282 TAICVLYVLIGVKLKRSRL------------LQSLPRRT-------------------------- 308
            :.|.|||:||||.|.||.|            |:|:|..|                          
  Fly   195 SIILVLYLLIGVHLYRSTLVEGPASVARRQQLKSVPSDTILYRYGGSGTAMSFNGGGSGAGTAGL 259

  Fly   309 -------FDANRG-LNAQG--RVIRMLVAVAVAFFLCWAPFHAQRLMAVY----GLNLINIGISR 359
                   ..:.|| ||..|  ||:||||||.|.|||||||||||||:|:|    |..|      |
  Fly   260 MGGSGAQLSSVRGRLNHYGTRRVLRMLVAVVVCFFLCWAPFHAQRLIAIYAPARGAKL------R 318

  Fly   360 DAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFG 408
            |.....:.::.|.|||||:||||||||||||||||||||||..|   ||
  Fly   319 DQHEFVYTVMTYVSGVLYYLSTCINPLLYNIMSHKFREAFKAVL---FG 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 78/130 (60%)
7tm_1 124..388 CDD:278431 151/318 (47%)
PK1-RNP_001014620.1 7tmA_capaR 21..358 CDD:320262 170/345 (49%)
TM helix 1 21..48 CDD:320262 15/27 (56%)
TM helix 2 55..81 CDD:320262 16/26 (62%)
TM helix 3 94..124 CDD:320262 23/30 (77%)
TM helix 4 136..158 CDD:320262 11/22 (50%)
TM helix 5 178..207 CDD:320262 17/29 (59%)
TM helix 6 277..307 CDD:320262 23/30 (77%)
TM helix 7 326..351 CDD:320262 19/25 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66616336
eggNOG 1 0.900 E33208_3BGH7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I2874
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24243
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
77.020

Return to query results.
Submit another query.