DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and OR7G2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001005193.1 Gene:OR7G2 HGNCID:8466 Length:345 Species:Homo sapiens

Alignment Length:383 Identity:79/384 (21%)
Similarity:138/384 (36%) Gaps:88/384 (23%)


  Fly    56 MLLLKND------KFLTHVAHLLNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCY 114
            |.||..|      :|:.:.....|.|..:...|||               :.|...|:..|...:
Human     3 MQLLLTDFIIFSIRFIINSMEARNQTAISKFLLLG---------------LIEDPELQPVLFSLF 52

  Fly   115 ALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDA 179
            ..:::..:||||:..:.:..::.:||...|:|.||:..|:.|..:.||:.|.|:...:. ..|.:
Human    53 LSMYLVTILGNLLILLAVISDSHLHTPMYFFLSNLSFLDICLSTTTIPKMLVNIQAQNR-SITYS 116

  Fly   180 MCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHT------------------------MS 220
            .|:.........|......:.|...:||:|||||.|...                        :|
Human   117 GCLTQICFVLFFAGLENCLLAAMAYDRYVAICHPLRYTVIMNPRLCGLLILLSLLTSVVNALLLS 181

  Fly   221 KLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTMENDFYAHVFAVSGFIFFGGPMTAIC 285
            .:...:.|...:.:..|...|.|.:|.:.       |.|:.|:...:..|.   ||.|.|::.|.
Human   182 LMVLRLSFCTDLEIPLFFCELAQVIQLTC-------SDTLINNILIYFAAC---IFGGVPLSGII 236

  Fly   286 VLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGL 350
            :.|..|      :..:..:|          :|.|:        ..|...|.:  |...::..||.
Human   237 LSYTQI------TSCVLRMP----------SASGK--------HKAVSTCGS--HLSIVLLFYGA 275

  Fly   351 NLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFG 408
            .| .:.|| ....|..|.....|.:.......:||.:|::.:    :..|.||.:..|
Human   276 GL-GVYIS-SVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRN----KDMKGTLRKFIG 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 32/152 (21%)
7tm_1 124..388 CDD:278431 60/288 (21%)
OR7G2NP_001005193.1 7tm_4 52..324 CDD:304433 65/315 (21%)
7tm_1 62..311 CDD:278431 60/288 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7811
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.