DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and CCHa1-R

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_611241.2 Gene:CCHa1-R FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster

Alignment Length:523 Identity:120/524 (23%)
Similarity:211/524 (40%) Gaps:121/524 (23%)


  Fly    68 VAHLLNITTENLSNLLGSTNGTNASTMAADSPVDESL---------------------------- 104
            :|:|:::.|:...|:...|:|...:.:.....|.|:|                            
  Fly     2 IANLVSMETDLAMNIGLDTSGEAPTALPPMPNVTETLWDLAMVVSQSTQWPLLDTGSSENFSELV 66

  Fly   105 TLRT------------ALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILL 157
            |..|            .:.:.:|||||.|||||....:|......|....|.|:.:||::||:::
  Fly    67 TTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVI 131

  Fly   158 VSGIP--QELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQ-HTM 219
            ::.:|  ..:|.:.|   :|:...:|.:...:.:::...:|.|:||.:.:||.||..|.|: |..
  Fly   132 ITTVPLASTVYTVEY---WPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAH 193

  Fly   220 SKLSRAIKFIFA----IWLAAFLLALPQAM----------QFSVV----YQNE-GYSCTMENDFY 265
            ....||.:...|    |||.|.|..||..:          :.|:|    |..| |.:       |
  Fly   194 GGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGIN-------Y 251

  Fly   266 AHVFAVSGF-IFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVA 329
            |....:..| :::..|:..|.|.||||.:.|..|   .|:|.....|.|.:.|:.:|...::|..
  Fly   252 AKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYS---ASVPGEIQGAVRQVRARRKVAVTVLAFV 313

  Fly   330 VAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHK 394
            |.|.:|:.|:|      |:.|.......::|.:|.::.:|...:..:.|.::|.||:....:|..
  Fly   314 VIFGICFLPYH------VFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGA 372

  Fly   395 FREAFKITLTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEPYGSYRVVQ 459
            ||:.|     .::...|....::.:..||:               ..|...:.:|....|.|   
  Fly   373 FRKHF-----NRYLFCRGASGRRKKRGQHD---------------TFCMHRDTSLTSTASKR--- 414

  Fly   460 FRCRDANHQLSLQDSIRTTTTTTTINSNSMAAGNGVGGGAGGGGGGRRLRKQELYGP---GPGTA 521
            |:.|.:.:|.:::......||.||:.:             ||...|..:...||..|   .||..
  Fly   415 FQSRHSCYQSTIRSCRLQETTITTLPN-------------GGNQNGANISAVELALPVLQAPGHN 466

  Fly   522 VPH 524
            ..|
  Fly   467 EAH 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 43/135 (32%)
7tm_1 124..388 CDD:278431 74/287 (26%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 32/103 (31%)
7tm_1 98..364 CDD:278431 74/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2468605
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.