DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Ntsr1

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001102437.1 Gene:Ntsr1 RGDID:1306076 Length:424 Species:Rattus norvegicus

Alignment Length:366 Identity:117/367 (32%)
Similarity:186/367 (51%) Gaps:56/367 (15%)


  Fly    78 NLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRN---NFMH 139
            :|||..|:|:.::.:...:|..|:..:..:..:|..|..:||.|.:||.:|...::|.   ..:.
  Rat    35 SLSNGSGNTSESDTAGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTAFTLARKKSLQSLQ 99

  Fly   140 TATNFYLFNLAVSDLILLVSGIPQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFT 203
            :..:::|.:||:|||::|:..:|.|||| :|....:.|.||.|.....|.:....||.|.:.:.:
  Rat   100 STVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLS 164

  Fly   204 VERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNE--------GYSCT- 259
            ||||:||||||:..|:...||..|||.|||||:.|||:|  |.|::..||.        |..|| 
  Rat   165 VERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIP--MLFTMGLQNRSGDGTHPGGLVCTP 227

  Fly   260 -MENDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKL--------KRSRLLQSLPRRTFDANRGL 315
             ::......|..|:.|:.|..||..|.:|..:|..||        ::.|:.      |...:.||
  Rat   228 IVDTATVKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRVC------TVGTHNGL 286

  Fly   316 N--------AQGRV------IRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFN--- 363
            .        ..|||      :.:|.||.:||.:||.|:|.:|||..|        ||.:.:.   
  Rat   287 EHSTFNMTIEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCY--------ISDEQWTTFL 343

  Fly   364 -DYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITL 403
             |::......:..|:::|:.|||:|||::|..||:.|..||
  Rat   344 FDFYHYFYMLTNALFYVSSAINPILYNLVSANFRQVFLSTL 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 53/132 (40%)
7tm_1 124..388 CDD:278431 97/304 (32%)
Ntsr1NP_001102437.1 7tm_1 81..369 CDD:278431 97/304 (32%)
Neurotensin binding 326..349 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.