DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and GPR39

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001499.1 Gene:GPR39 HGNCID:4496 Length:453 Species:Homo sapiens

Alignment Length:471 Identity:117/472 (25%)
Similarity:190/472 (40%) Gaps:89/472 (19%)


  Fly    85 STNGTNASTMAADSPVDE---SLTLRTALTVCYALIFVAGVLGNLIT---CIVISRNNFMHTATN 143
            |..|::.|.:...|.|.|   :..::..|.:.|.:|||.|:|||..|   ..|:.:..::.....
Human     5 SLPGSDCSQIIDHSHVPEFEVATWIKITLILVYLIIFVMGLLGNSATIRVTQVLQKKGYLQKEVT 69

  Fly   144 FYLFNLAVSDLILLVSGIPQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERY 207
            .::.:||.||:::.:.|:|.|.|: :|.|.........|.:.:.|.|..:.||:|.:...:.|||
Human    70 DHMVSLACSDILVFLIGMPMEFYSIIWNPLTTSSYTLSCKLHTFLFEACSYATLLHVLTLSFERY 134

  Fly   208 IAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVY------QNEGYSCTMENDFYA 266
            ||||||||...:|...:....|..:|:.:.|:|||........|      .:.|.:|...:..:.
Human   135 IAICHPFRYKAVSGPCQVKLLIGFVWVTSALVALPLLFAMGTEYPLVNVPSHRGLTCNRSSTRHH 199

  Fly   267 H------------------VFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPR------- 306
            .                  ||..|.|..|      :..|.||:.|......::|.|.:       
Human   200 EQPETSNMSICTNLSSRWTVFQSSIFGAF------VVYLVVLLSVAFMCWNMMQVLMKSQKGSLA 258

  Fly   307 --------RTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFN 363
                    |..::.....|:.:.|..|..:.|...:||.|...:|:||.       .....|...
Human   259 GGTRPPQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQIRRIMAA-------AKPKHDWTR 316

  Fly   364 DYFR---ILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNY 425
            .|||   ||...|...::||:.||||||.:.|.:||..|...|..:..|...:|.::.:.|.|:.
Human   317 SYFRAYMILLPFSETFFYLSSVINPLLYTVSSQQFRRVFVQVLCCRLSLQHANHEKRLRVHAHST 381

  Fly   426 S------------ALLRQNGSMRLQPASCSVNNNALEPYGSYRVVQFRCRDANHQLSLQDSIRTT 478
            :            |..||:.:.|.:....|...:..||           :..:..||| :|:...
Human   382 TDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEP-----------QSKSQSLSL-ESLEPN 434

  Fly   479 TTTTTINSNSMAAGNG 494
            :.....||   ||.||
Human   435 SGAKPANS---AAENG 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 43/132 (33%)
7tm_1 124..388 CDD:278431 77/310 (25%)
GPR39NP_001499.1 7tmA_GPR39 31..355 CDD:320263 88/337 (26%)
TM helix 1 31..58 CDD:320263 11/27 (41%)
TM helix 2 68..94 CDD:320263 8/26 (31%)
TM helix 3 108..138 CDD:320263 12/30 (40%)
TM helix 4 150..172 CDD:320263 6/22 (27%)
TM helix 5 217..246 CDD:320263 9/35 (26%)
TM helix 6 276..306 CDD:320263 9/30 (30%)
TM helix 7 323..348 CDD:320263 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.