DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and MLNR

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001498.1 Gene:MLNR HGNCID:4495 Length:412 Species:Homo sapiens

Alignment Length:401 Identity:123/402 (31%)
Similarity:178/402 (44%) Gaps:104/402 (26%)


  Fly    83 LGST-NGTNASTMAAD------SPVDE---------SLTLRTALTVCYALIFVAGVLGNLITCIV 131
            :||. ||::....|.:      .|.||         :|...||:.:|   :||.||.||::|.::
Human     1 MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLC---LFVVGVSGNVVTVML 62

  Fly   132 ISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATV 196
            |.|...|.|.||.||.::|||||::|: |:|.:||.||....:.|...:|.:...:.|....||:
Human    63 IGRYRDMRTTTNLYLGSMAVSDLLILL-GLPFDLYRLWRSRPWVFGPLLCRLSLYVGEGCTYATL 126

  Fly   197 LTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSV-VYQNEGYSCTM 260
            |.:||.:||||:|||.|.|...:....|....|..:|..|.|.|.|  ..|.| |.|:.|.|...
Human   127 LHMTALSVERYLAICRPLRARVLVTRRRVRALIAVLWAVALLSAGP--FLFLVGVEQDPGISVVP 189

  Fly   261 ENDFYAHV----------------------------------------------------FAVSG 273
            ..:..|.:                                                    :..:.
Human   190 GLNGTARIASSPLASSPPLWLSRAPPPSPPSGPETAEAAALFSRECRPSPAQLGALRVMLWVTTA 254

  Fly   274 FIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGR------VIRMLVAVAVAF 332
            :.|.  |...:.:||.|||.:|..|       ||..   ||..|.||      .:|:|:.|.:||
Human   255 YFFL--PFLCLSILYGLIGRELWSS-------RRPL---RGPAASGRERGHRQTVRVLLVVVLAF 307

  Fly   333 FLCWAPFHAQRLMAVYGLNLINIGISRDA-FNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFR 396
            .:||.|||..|:  :|    ||...||.. |:.||.|:...   |::||..|||:|||::|.|:|
Human   308 IICWLPFHVGRI--IY----INTEDSRMMYFSQYFNIVALQ---LFYLSASINPILYNLISKKYR 363

  Fly   397 -EAFKITLTRQ 406
             .|||:.|.|:
Human   364 AAAFKLLLARK 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 50/128 (39%)
7tm_1 124..388 CDD:278431 97/324 (30%)
MLNRNP_001498.1 7tm_1 55..355 CDD:278431 97/324 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66656302
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.