DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and GHSR

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_940799.1 Gene:GHSR HGNCID:4267 Length:366 Species:Homo sapiens

Alignment Length:371 Identity:131/372 (35%)
Similarity:176/372 (47%) Gaps:61/372 (16%)


  Fly    48 ANPSESPEMLLLKNDKFLTHVAHLLNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTA--- 109
            |.|||.|.                .|:|..:|.        .:||. ..||..||.|.|..|   
Human     4 ATPSEEPG----------------FNLTLADLD--------WDASP-GNDSLGDELLQLFPAPLL 43

  Fly   110 ---LTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYP 171
               ...|.|| ||.|:.|||:|.:|:||...:.|.||.||.::|.|||::.:. :|.:|..||..
Human    44 AGVTATCVAL-FVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLC-MPLDLVRLWQY 106

  Fly   172 DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAA 236
            ..:.|.|.:|.:...:||....||||||||.:||||.|||.|.|...:....|....||.||..|
Human   107 RPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVA 171

  Fly   237 FLLALPQAMQFSVVYQNEGYSCTMENDFYAHVFAV-SGF---------IFFGGPMTAICVLYVLI 291
            |..|.|..:...|.::| |......|:.....||| ||.         |||..|:..:.|||.||
Human   172 FCSAGPIFVLVGVEHEN-GTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLI 235

  Fly   292 GVKLKRSRLLQSLPRRTFDANRGLNAQG----RVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNL 352
            |.||.|        ||..||..|.:.:.    :.::||..|..||.|||.|||..|.:.......
Human   236 GRKLWR--------RRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEP 292

  Fly   353 INIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREA 398
            .::.|::  .:.|..::.:   ||::||..|||:||||||.|:|.|
Human   293 GSLEIAQ--ISQYCNLVSF---VLFYLSAAINPILYNIMSKKYRVA 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 55/128 (43%)
7tm_1 124..388 CDD:278431 100/278 (36%)
GHSRNP_940799.1 7tmA_GHSR 44..334 CDD:320259 114/307 (37%)
TM helix 1 44..71 CDD:320259 13/28 (46%)
TM helix 2 78..103 CDD:320259 10/26 (38%)
TM helix 3 116..146 CDD:320259 17/30 (57%)
TM helix 4 158..180 CDD:320259 9/22 (41%)
TM helix 5 209..238 CDD:320259 10/29 (34%)
TM helix 6 256..286 CDD:320259 12/30 (40%)
TM helix 7 302..327 CDD:320259 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66682137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.