DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and Olfr835

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001012266.1 Gene:Olfr835 / 257872 MGIID:3030669 Length:311 Species:Mus musculus


Alignment Length:353 Identity:71/353 - (20%)
Similarity:129/353 - (36%) Gaps:86/353 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LGSTNGTNASTM----AADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATN 143
            :|..|.|:.|..    ..|.|     |::..:...:.|:::..:||||:..:.:...:.:.|...
Mouse     1 MGGKNQTDVSHFFLLGLTDDP-----TVKPVIFCIFLLMYMVTILGNLLIILAVCSYSHLQTPMY 60

  Fly   144 FYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYI 208
            |::.||:::|:.|..:.||..|......|. ..:.|.|:.......:.|......:.|...:||:
Mouse    61 FFISNLSINDICLSTTVIPNMLRTTQTQDQ-SISYAGCLTQLCFVLLFAGFESCLLAAMAYDRYV 124

  Fly   209 AICHPFRQHTMSKL-SRAIKFIFAIWLAA-----------------------FLLALPQAMQFSV 249
            |||:|.....|... |.|:..:|::.::.                       |...|.|.|:.:.
Mouse   125 AICYPLSYTVMMNFHSCALLILFSVLISVLNMGLLGLMVLRLSFCTNLEIPLFFCELSQVMKLAC 189

  Fly   250 VYQNEGYSCTMENDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRG 314
                   |.|:.||...:   ::.|||.|.|::.|...||.|...:.|..               
Mouse   190 -------SDTLINDILIY---LATFIFGGIPISGIIFSYVQIASSVLRIS--------------- 229

  Fly   315 LNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNL---INIGISRDAFNDYFRILDYTSGVL 376
             :.:||        ..||..|.:  |.......||..|   |...::         ||...:.|.
Mouse   230 -SVKGR--------CKAFSTCGS--HLSVTSLSYGSGLWVYITSSVA---------ILPKKTSVA 274

  Fly   377 YFLSTCI----NPLLYNIMSHKFREAFK 400
            ..:.|.:    ||.::::.:...:...|
Mouse   275 CIMYTVVPQMLNPFIFSLRNKDMKGTMK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 30/151 (20%)
7tm_1 124..388 CDD:278431 61/294 (21%)
Olfr835NP_001012266.1 7tm_4 31..306 CDD:304433 64/318 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7811
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.