DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Cckbr

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_037297.1 Gene:Cckbr RGDID:2290 Length:452 Species:Rattus norvegicus

Alignment Length:412 Identity:102/413 (25%)
Similarity:164/413 (40%) Gaps:122/413 (30%)


  Fly    87 NGTNASTMAADSP-----VDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYL 146
            |.::|..::.|.|     ....|.:...:|: ||:||:..|.||::..:|:..:..:.|.||.:|
  Rat    30 NSSSAGNLSCDPPRIRGTGTRELEMAIRITL-YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFL 93

  Fly   147 FNLAVSDLILLVSGIPQELYNLWYPDM---YPFTDAMCIMGSVLSEMAANATVLTITAFTVERYI 208
            .:||||||:|.|:.:|..|    .|::   :.|...:|...|.|..::.:.:.|.:.|..:|||.
  Rat    94 LSLAVSDLLLAVACMPFTL----LPNLMGTFIFGTVICKAISYLMGVSVSVSTLNLVAIALERYS 154

  Fly   209 AICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSV------VYQ--NEGYSCTMENDFY 265
            |||.|.:.......|.|.:.|.|.||.:.||.:|..:...|      |.|  :...|..::..:.
  Rat   155 AICRPLQARVWQTRSHAARVILATWLLSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWS 219

  Fly   266 AHVFAVSGFIFFGGPMTAICVLYVLIG-------------------------------------- 292
            ..:..:..||    |...|.|.|.||.                                      
  Rat   220 VLLLLLLFFI----PGVVIAVAYGLISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQ 280

  Fly   293 -------------------VKLKRSRL-LQSLPRRTFDANRG-------LNAQGRVIRMLVAVAV 330
                               |:|.|||| :.:|...|.....|       |.|:.||:|||:.:.:
  Rat   281 NGGCRPVTSVAGEDSDGCCVQLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVL 345

  Fly   331 AFFLCWAPFH------------AQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCI 383
            .|||||.|.:            |||.::...::.|::                    |.::|.|:
  Rat   346 LFFLCWLPVYSVNTWRAFDGPGAQRALSGAPISFIHL--------------------LSYVSACV 390

  Fly   384 NPLLYNIMSHKFREAFKITLTR 405
            |||:|..|..:||:|...|..|
  Rat   391 NPLVYCFMHRRFRQACLDTCAR 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 44/131 (34%)
7tm_1 124..388 CDD:278431 84/352 (24%)
CckbrNP_037297.1 7tm_4 60..>243 CDD:304433 57/192 (30%)
7tm_1 71..395 CDD:278431 84/352 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.