DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and NTSR2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_036476.2 Gene:NTSR2 HGNCID:8040 Length:410 Species:Homo sapiens

Alignment Length:377 Identity:97/378 (26%)
Similarity:159/378 (42%) Gaps:82/378 (22%)


  Fly   100 VDESLTLRTALTVCYALIFVAGVLGNLITCIVISR------NNFMHTATNFYLFNLAVSDLILLV 158
            ||..|..:...|..||||:..|..||.::..|:.:      ....|     ::.:||::.|:||:
Human    25 VDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRH-----HVLSLALAGLLLLL 84

  Fly   159 SGIPQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKL 222
            .|:|.|||: :|:...:.|.|..|.....:.|:.|.||||::...:.||.:|:|.|.|..::...
Human    85 VGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQPLRARSLLTP 149

  Fly   223 SRAIKFIFAIWLAAFLLALPQAMQFSVVYQNE---------GYSCTM------------ENDFYA 266
            .|....:...|.|:..||||.|:.....::.|         ...||:            .|...:
Human   150 RRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVS 214

  Fly   267 HVFAVSGFIFFGG----PMTAICVLYVLIGVK----------LKRSRLLQSLP-RRTF------- 309
            .|..::...|..|    .:.|:|.........          |....||..:. ::||       
Human   215 FVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVS 279

  Fly   310 -----DANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFND----- 364
                 |..| :.:..|.:::|.|:.|.:.:||.|:||:|||..|        :..||:.|     
Human   280 LVRHKDVRR-IRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCY--------VPDDAWTDPLYNF 335

  Fly   365 --YFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHH 414
              ||.::..|   |:::|:.:.|||||.:|..||:.|   |.....|...||
Human   336 YHYFYMVTNT---LFYVSSAVTPLLYNAVSSSFRKLF---LEAVSSLCGEHH 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 41/135 (30%)
7tm_1 124..388 CDD:278431 78/326 (24%)
NTSR2NP_036476.2 7tmA_NTSR2 33..369 CDD:320478 89/353 (25%)
TM helix 1 33..60 CDD:320478 9/27 (33%)
TM helix 2 68..94 CDD:320478 11/31 (35%)
TM helix 3 108..138 CDD:320478 10/30 (33%)
TM helix 4 152..170 CDD:320478 6/18 (33%)
TM helix 5 203..232 CDD:320478 4/29 (14%)
TM helix 6 290..320 CDD:320478 12/30 (40%)
TM helix 7 337..362 CDD:320478 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.