DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Nmur2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_694719.2 Gene:Nmur2 MGIID:2441765 Length:395 Species:Mus musculus

Alignment Length:427 Identity:132/428 (31%)
Similarity:208/428 (49%) Gaps:73/428 (17%)


  Fly    72 LNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNN 136
            ||.|.|.|:.|.|              |....|:|  .::|.||||||.||:|||:.|:||:|:.
Mouse    18 LNSTEEYLAYLCG--------------PKRSDLSL--PVSVVYALIFVVGVIGNLLVCLVIARHQ 66

  Fly   137 FMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITA 201
            .:.|.||:|||:||||||::|:.|:|.|:|.||:...:.|....|...:.|.|....|::|::|.
Mouse    67 TLKTPTNYYLFSLAVSDLLVLLLGMPLEVYELWHNYPFLFGPVGCYFKTALFETVCFASILSVTT 131

  Fly   202 FTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQN--EGYS------C 258
            .::|||:||.||||....|...||::.:..:|..:.:.:||......:.:|.  .|.|      |
Mouse   132 VSIERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIKFQQFPNGSSVPGSATC 196

  Fly   259 TMENDFYAHVFAV--SGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRV 321
            |:....:.:.|.:  :.|:|:..|||.|.|||.|:|::|||...|:: .:.|.:.:|  .::..|
Mouse   197 TVTKPIWVYNFIIQATSFLFYILPMTLISVLYYLMGLRLKRDESLEA-DKVTVNIHR--PSRKSV 258

  Fly   322 IRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPL 386
            .:||..:.:.|.:||.|||..||...:      :....::....|.::...|||.::||:.:||:
Mouse   259 TKMLFVLVLVFAICWTPFHVDRLFFSF------VDEWTESLAAVFNLIHVVSGVFFYLSSAVNPI 317

  Fly   387 LYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEP 451
            :||::|.:||.||:..::......         |.||      |..|                 |
Mouse   318 IYNLLSRRFRAAFRNVVSPSCKWC---------HPQH------RPQG-----------------P 350

  Fly   452 YGSYRVVQFRC------RDANHQLSLQDSIRTTTTTT 482
            .....:....|      .||..|...|.||..|..||
Mouse   351 PAQKVIFLTECHLVELTEDAGPQFPCQSSIHNTQLTT 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 55/128 (43%)
7tm_1 124..388 CDD:278431 90/274 (33%)
Nmur2NP_694719.2 7tm_4 48..333 CDD:304433 101/294 (34%)
7tm_1 54..319 CDD:278431 90/274 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66674832
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T130989
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.