DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Ghsr

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_017175002.1 Gene:Ghsr MGIID:2441906 Length:427 Species:Mus musculus

Alignment Length:411 Identity:138/412 (33%)
Similarity:189/412 (46%) Gaps:72/412 (17%)


  Fly    24 AHVSP--SPNQSPSIGVGIGIASSTM--------------ANPSESPEMLLLKNDKFLTHVAHLL 72
            ||.||  :|..:|::....|....|.              |.|||.||.                
Mouse    27 AHSSPHAAPRPAPTLPRLGGPPQGTRFPRGCDPKPGNMWNATPSEEPEP---------------- 75

  Fly    73 NITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTA------LTVCYALIFVAGVLGNLITCIV 131
            |:|.:    |....:..|      ||..||.|.|..|      ...|.|| ||.|:.|||:|.:|
Mouse    76 NVTLD----LDWDASPGN------DSLSDELLPLFPAPLLAGVTATCVAL-FVVGISGNLLTMLV 129

  Fly   132 ISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATV 196
            :||...:.|.||.||.::|.|||::.:. :|.:|..||....:.|.|.:|.:...:||....|||
Mouse   130 VSRFRELRTTTNLYLSSMAFSDLLIFLC-MPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATV 193

  Fly   197 LTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTME 261
            |||||.:||||.|||.|.|...:....|....|..||..||..|.|..:...|.::| |......
Mouse   194 LTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHEN-GTDPRDT 257

  Fly   262 NDFYAHVFAV-SGF---------IFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLN 316
            |:..|..||| ||.         :||..|:..:.|||.|||.||.|.|...::.....|.|    
Mouse   258 NECRATEFAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWRRRGDAAVGSSLRDQN---- 318

  Fly   317 AQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLST 381
             ..:.::||..|..||.|||.|||..|.:........::.|::  .:.|..::.:   ||::||.
Mouse   319 -HKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQ--ISQYCNLVSF---VLFYLSA 377

  Fly   382 CINPLLYNIMSHKFREA-FKI 401
            .|||:||||||.|:|.| ||:
Mouse   378 AINPILYNIMSKKYRVAVFKL 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 54/128 (42%)
7tm_1 124..388 CDD:278431 97/274 (35%)
GhsrXP_017175002.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66677418
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.