DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and nmur-3

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001024524.1 Gene:nmur-3 WormBaseID:WBGene00017176 Length:445 Species:Caenorhabditis elegans

Alignment Length:456 Identity:122/457 (27%)
Similarity:196/457 (43%) Gaps:107/457 (23%)


  Fly    49 NPSESPEMLLLKNDKFLTHVAH-----LLNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRT 108
            |.|.:|    :...:.:.|..|     |.::|.::|.:.....|.::...:     :|.:. |..
 Worm    22 NNSNTP----ITTKELIKHCFHPDVQFLAHMTLKSLDHPGEQFNNSSNQLL-----LDRAF-LNP 76

  Fly   109 ALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYP-- 171
            .||:.:..:.:.|::|||:|.|||.:.|.:|:.||::|.|||.||..|:|.|:..:|.|:|..  
 Worm    77 ILTLIFVFVGLVGLIGNLLTVIVIFKTNSLHSHTNYFLANLATSDFCLIVVGVSFDLVNIWNDEE 141

  Fly   172 --DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWL 234
              |::.:    |.:.|....:...|::|||...|.||:.|||:||...|:....|..:||..||.
 Worm   142 PLDIFGY----CSLTSTFISLFTFASILTIVLLTAERFTAICYPFSHRTIFDEKRVKRFILLIWF 202

  Fly   235 AAFLLALPQAMQFSVVYQNE-GYS--------C---TMENDFYAHVFAVSGFIFFGGPMTAICVL 287
            .|.|.::.....|..|.|:. |::        |   |..:.|:.:.|..:..|.|..|:..|...
 Worm   203 VALLPSIFIGSMFKRVSQDFCGFNRQMTYIGRCDLVTSPDSFFRYPFESAITITFVLPLFFIIYC 267

  Fly   288 Y---------VLIGVKLKRSRLL---------------------------------------QSL 304
            |         :.|.|.|..:..:                                       ||.
 Worm   268 YFRILGTRHFLCITVNLSYTSNIFPVTLNEMSNSTHVHTPVGTARSDSGAFPFPHTSNNSNTQSF 332

  Fly   305 PRRTFDAN----RGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFN-D 364
            |......|    |...||..||:|||.|...||:|:.|:|||||:..|.        |:|..| |
 Worm   333 PLTVHTKNVQPPRSQQAQKMVIKMLVTVTAVFFVCYLPYHAQRLIVKYN--------SKDCSNSD 389

  Fly   365 YFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYSALL 429
            :.::|...:|:|.::|..:||:.||:||.:||..||..:...:.           |...:||.|.
 Worm   390 FCKLLYPIAGILQYISASLNPIFYNLMSVRFRNGFKKLIKDVWA-----------HRARSYSNLA 443

  Fly   430 R 430
            |
 Worm   444 R 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 47/132 (36%)
7tm_1 124..388 CDD:278431 95/333 (29%)
nmur-3NP_001024524.1 7tm_4 82..>224 CDD:304433 50/146 (34%)
7tm_1 92..413 CDD:278431 95/333 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.