DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and npr-35

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001023088.1 Gene:npr-35 WormBaseID:WBGene00016842 Length:381 Species:Caenorhabditis elegans

Alignment Length:368 Identity:95/369 (26%)
Similarity:154/369 (42%) Gaps:55/369 (15%)


  Fly   103 SLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYN 167
            |..|....||.|..:|..|||||....:.:..:..::..|::.:.:||::||.:|...:|..|.|
 Worm    25 SYQLTVLYTVAYGAVFFTGVLGNTFVVLAVWAHKNLNITTDYLILSLALADLFILWICLPTTLIN 89

  Fly   168 ------LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAI 226
                  ||       ....|.:.:..:...:.|:|.|:.|.|.:||:||||..:.:|........
 Worm    90 SIFTEWLW-------GQFFCRLSTWANASTSFASVYTLVAVTADRYLAICHTLKYNTSWDREYTK 147

  Fly   227 KFIFAIWLAAFLLALPQAMQFS-VVYQNEGYS---CTMENDFYAHVFAVSGFIFFGGPMTAICVL 287
            ..|||:||.|.:..:|....:. :|:|...|.   ||.:.|...:...|:..:.|..|...|..|
 Worm   148 YVIFAVWLVAAIFGIPNWYNYDLIVWQEGSYGYRLCTSQTDQKLYFLFVNLLLAFIVPFGLISGL 212

  Fly   288 YVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNL 352
            |..|.:.:...|.|....|...|     ..:.||..|::.|.:.|..||.|.:.   :..|    
 Worm   213 YTRIFITVSTHRSLAVDARARED-----RVKLRVATMMLTVIIVFACCWLPLYC---IFTY---- 265

  Fly   353 INIGISRDAFNDYFRILDYTSGVLY----FLSTCINPLLYNIMSHKFREAFKITL-----TRQFG 408
              .....|..:|.|:|.......::    .||:.:||::|...|||:|.|||..|     ||   
 Worm   266 --FFFFADQRSDLFQITSMLIRPIFQWMSLLSSSLNPIIYIAYSHKYRRAFKSILLMPCKTR--- 325

  Fly   409 LARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEP 451
                        ::...|.:||::.......|:.|::|...||
 Worm   326 ------------YERVRSTILRRHSRGFKSTATISMSNFGTEP 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 37/134 (28%)
7tm_1 124..388 CDD:278431 67/278 (24%)
npr-35NP_001023088.1 7tm_4 41..>238 CDD:304433 53/209 (25%)
7tm_1 46..303 CDD:278431 67/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66616446
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.