DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and trhr-1

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_491990.1 Gene:trhr-1 WormBaseID:WBGene00016265 Length:395 Species:Caenorhabditis elegans

Alignment Length:417 Identity:118/418 (28%)
Similarity:191/418 (46%) Gaps:88/418 (21%)


  Fly    42 IASSTMANPSESPEMLLLKNDKFLTHVAHLLNITTENLSNLLGSTNGTNASTMAADSPVDESLTL 106
            :.|:::|..|.||                   |..|.|       :||.|.  ....|:|     
 Worm     1 MTSASLAGISISP-------------------IVPEEL-------DGTIAP--IGTQPMD----- 32

  Fly   107 RTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYP 171
             ..|...::.|.|.||||||:...|:.:...|.|.||.||.:||.||.:...:.:|.|:..|..|
 Worm    33 -ITLAFVFSAISVIGVLGNLLVITVVLKVRGMKTPTNCYLVSLAASDTLFFFASMPHEMMYLLGP 96

  Fly   172 -DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLA 235
             |.|.|....|::.:.|..:|.|.:.|:|.|||:|||..||:|::..||..:.||...|..||:.
 Worm    97 NDHYLFGSLGCVLLTYLPYLAMNTSSLSILAFTIERYYGICNPYKARTMCTVKRATCIICGIWIF 161

  Fly   236 AFLLALPQAMQFSVVYQNEGYSCT--MENDFYAH--VFAVSGFIFFGGPMTAICVLYVLIGV--- 293
            :.|.........:::..:.|.||:  :|.:.:|:  ||.:...:::..|:....::|..||:   
 Worm   162 SMLYHSYWLFLATLIKDDIGTSCSFRLERNSHAYKIVFLLDFVLWYVLPIMCDIIIYAKIGITLS 226

  Fly   294 ----KLKRSRLLQSLPR-------RTFDANRG-------------LNAQGR--VIRMLVAVAVAF 332
                |:|:| :...:|.       :|...:.|             .:|:||  |::||..|...|
 Worm   227 QCGDKIKKS-VKPKIPNEVIVEKSKTSSTSMGHYSGRDSHISGKRNSAKGRNQVVKMLAIVVAVF 290

  Fly   333 FLCWAPFHAQRLMAVYGLNLINIGISRDAFN---DYFRILDYTSGVLYFLSTCINPLLYNIMSHK 394
            .:||.|:   |.|.||     |..:|...::   |::..|..|   |.|::..|||:|||:||.:
 Worm   291 AVCWLPY---RGMVVY-----NSFVSDPKYSWSPDWYINLSKT---LVFINCAINPILYNLMSAR 344

  Fly   395 FREAFKITLTRQ-----FGLARNHHHQ 416
            ||.||:..|:::     ...|.|..|:
 Worm   345 FRAAFRSLLSKRKNSGFKSTALNQRHR 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 49/129 (38%)
7tm_1 124..388 CDD:278431 87/301 (29%)
trhr-1NP_491990.1 7tm_4 42..>171 CDD:304433 49/129 (38%)
7tm_1 49..338 CDD:278431 87/301 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I2874
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.