DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Ntsr2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_032773.2 Gene:Ntsr2 MGIID:108018 Length:416 Species:Mus musculus

Alignment Length:377 Identity:100/378 (26%)
Similarity:165/378 (44%) Gaps:83/378 (22%)


  Fly   100 VDESLTLRTALTVCYALIFVAGVLGNLITC-IVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQ 163
            ||..|..:...|..|:|||..|..||.::. :|:...........:::.:||:|.|:||:..:|.
Mouse    25 VDTRLWAKVLFTALYSLIFALGTAGNALSVHVVLKARAGRPGRLRYHVLSLALSALLLLLISVPM 89

  Fly   164 ELYN-LW--YPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRA 225
            |||| :|  ||  :.|.|..|.....:.|:.|.||||::.:.:.||.:|:|.|.|...:....|.
Mouse    90 ELYNFVWSHYP--WVFGDLGCRGYYFVRELCAYATVLSVASLSAERCLAVCQPLRARRLLTPRRT 152

  Fly   226 IKFIFAIWLAAFLLALPQAMQFSVVYQNE---------GYSCTM------------ENDFYAHVF 269
            .:.:..:|:|:..||||.|:.....::.|         ...||:            .|...:.|.
Mouse   153 RRLLSLVWVASLGLALPMAVIMGQKHEMERADGEPEPASRVCTVLVSRATLQVFIQVNVLVSFVL 217

  Fly   270 AVSGFIFFGG-PMTAICVLYVLIGVKLKRSRLLQSLP-----------------RRTF------- 309
            .::...|..| .:..:..||..:.   ..|..:.|:|                 |:|.       
Mouse   218 PLALTAFLNGITVNHLVALYSQVP---SASAQVNSIPSRLELLSEEGLLGFITWRKTLSLGVQAS 279

  Fly   310 -----DAN--RGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFND--- 364
                 ||:  |.|....:|:|.:|||   :.:||.|:||:|||..|        |..|.:.|   
Mouse   280 LVRHKDASQIRSLQHSAQVLRAIVAV---YVICWLPYHARRLMYCY--------IPDDGWTDELY 333

  Fly   365 ----YFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARN 412
                ||.::..|   |:::|:.:.|:|||.:|..||:.|..:|:...|..|:
Mouse   334 DFYHYFYMVTNT---LFYVSSAVTPVLYNAVSSSFRKLFLESLSSLCGEQRS 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 43/132 (33%)
7tm_1 124..388 CDD:278431 82/328 (25%)
Ntsr2NP_032773.2 7tm_1 85..358 CDD:278431 73/292 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.