DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and Ntsr1

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_061236.1 Gene:Ntsr1 MGIID:97386 Length:424 Species:Mus musculus

Alignment Length:422 Identity:128/423 (30%)
Similarity:198/423 (47%) Gaps:82/423 (19%)


  Fly    25 HVSPSPNQSPSIGVGIGIASSTMANPSESPEMLLLKNDKFLTHVAHLLNITTENLSNLLGSTNGT 89
            |::.|..|        |..|...|.|...|:..|                  |.:...|..:||:
Mouse     2 HLNSSVQQ--------GAPSEPGAQPFPHPQFGL------------------ETMLLALSLSNGS 40

  Fly    90 NASTMAADSP-----VDESLTLRTALTVCYALIFVAGVLGNLITCIVISRN---NFMHTATNFYL 146
            ..|:.:...|     |:..:..:..:|..|..:||.|.:||.:|...::|.   ..:.:..:::|
Mouse    41 GNSSESILEPNSNLDVNTDIYSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHL 105

  Fly   147 FNLAVSDLILLVSGIPQELYN-LWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAI 210
            .:||:|||::|:..:|.|||| :|....:.|.||.|.....|.:....||.|.:.:.:||||:||
Mouse   106 GSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAI 170

  Fly   211 CHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNE--------GYSC--TMENDFY 265
            ||||:..|:...||..|||.|||||:.|||:|  |.|::..||.        |..|  |::....
Mouse   171 CHPFKAKTLMSRSRTKKFISAIWLASALLAVP--MLFTMGLQNRSADGQHPGGLVCTPTVDTATV 233

  Fly   266 AHVFAVSGFIFFGGPMTAICVLYVLIGVKL--------KRSRLL------QSLPRRTFDANRGLN 316
            ..|..|:.|:.|..||..|.:|..:|..||        ::.|.:      .||...||  |..:.
Mouse   234 KVVIQVNTFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVGTHNSLEHSTF--NMSIE 296

  Fly   317 AQGRV------IRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFN----DYFRILDY 371
             .|||      :.:|.||.:||.:||.|:|.:|||..|        ||.:.:.    |::.....
Mouse   297 -PGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCY--------ISDEQWTTFLFDFYHYFYM 352

  Fly   372 TSGVLYFLSTCINPLLYNIMSHKFREAFKITL 403
            .:..|:::|:.|||:|||::|..||:.|..||
Mouse   353 LTNALFYVSSAINPILYNLVSANFRQVFLSTL 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 53/132 (40%)
7tm_1 124..388 CDD:278431 99/302 (33%)
Ntsr1NP_061236.1 7tm_1 80..369 CDD:278431 99/302 (33%)
Neurotensin binding. {ECO:0000250} 326..349 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.