DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and C24B5.1

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_505381.2 Gene:C24B5.1 WormBaseID:WBGene00016044 Length:427 Species:Caenorhabditis elegans

Alignment Length:433 Identity:90/434 (21%)
Similarity:160/434 (37%) Gaps:108/434 (25%)


  Fly    51 SESPEMLL---LKNDKFLTHVAHLLNITTENLSNLLGSTNGTNA----------STMAADSPVDE 102
            |.:.::||   :::|.....:.|.||.:.|...:.:.:|:....          .|:...||..|
 Worm     2 SSAAQLLLDSAVRDDDDPIFLYHHLNASLEAAKDAVNATSVKQILEAQTHYLFNDTIFGPSPAME 66

  Fly   103 SLTLRTALTVCYAL-----IFVAGVLGNLITCIVISRNNFMH-TATNFYLFNLAVSDLILLVSGI 161
            |...|:.:...|..     :|| |:.||.:..|:|..|..:: ..||.||..||....|.|:|.:
 Worm    67 STPGRSLIQNLYYFYMPFCVFV-GLTGNTMVWILIRSNRMLNKLPTNVYLLCLAAMSSIFLLSLL 130

  Fly   162 P---QELYNLWYPDMYPFTDAM-------CIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQ 216
            .   :|:..:::.|:  |.|::       ||..:.|:.:...|:|..|....:||.:.:....|.
 Worm   131 VFWIEEVAYIYFYDI--FQDSLLRNSYYSCIFNTFLAHVCDFASVWLIVLVGLERLLLLYRKTRG 193

  Fly   217 HTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTMENDF---YAHVFAVSGFIFFG 278
            .|..| :||..||    |..|.:.....:.|......|| .|.::.:|   |..:..|...|...
 Worm   194 LTCEK-ARAQVFI----LLGFAMVFNGWILFVADMDEEG-QCDIKIEFVGMYQTMTIVETIICML 252

  Fly   279 GP----MTAICVLYVLIGVKLKR----------------------------------SRL---LQ 302
            .|    :|..|::...:...:|:                                  ||.   ::
 Worm   253 VPSVLIITCNCLVVSKLNSHIKKNPGSPAVSFNTADVVLTTQTSAPSATLKSYTRISSRFSIDVE 317

  Fly   303 SLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAV-YGLN-------LINIGISR 359
            ..|::.....|..:.|  :.|.|:.|..||.|...|.:..|:.:: :|::       .|::|.  
 Worm   318 KAPKKKKKGIRYTDIQ--LTRSLLVVTWAFILLNIPNYGYRIASILFGISEQSSLMTAISLGA-- 378

  Fly   360 DAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKIT 402
                   .:..||.....|       .||...|.:.:...|.|
 Worm   379 -------HVFLYTHHAFLF-------YLYIFYSPQMKRRLKPT 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 39/144 (27%)
7tm_1 124..388 CDD:278431 67/327 (20%)
C24B5.1NP_505381.2 7tm_1 92..>279 CDD:278431 47/195 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.