DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and nmur-2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_493666.2 Gene:nmur-2 WormBaseID:WBGene00019616 Length:403 Species:Caenorhabditis elegans

Alignment Length:324 Identity:113/325 (35%)
Similarity:168/325 (52%) Gaps:41/325 (13%)


  Fly   112 VCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELY-NLWYPDMYP 175
            :.|..||:.|:.||:.|||||:.|..||..||:|||:|||||:|.|:.|:|.|.| :|.|...|.
 Worm    36 IIYGTIFLLGLFGNICTCIVIAANKSMHNPTNYYLFSLAVSDIIALILGLPMEFYQSLDYSYPYR 100

  Fly   176 FTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLA 240
            |::.:|...:.|.|..:.|:::.|..|:.||::|||||.|....|.|.||...|...|..:|:.|
 Worm   101 FSEGICKARAFLIEFTSYASIMIICCFSFERWLAICHPLRSKIFSTLWRANVLIILAWTISFVCA 165

  Fly   241 LPQAMQFSV---------VYQNEGYSCTMENDFYAH------------------VFAVSGFIFFG 278
            ||.|....:         .||......:.:..|..|                  :||.:  :||.
 Worm   166 LPIAFIVQINKLPLPEDAKYQPWTNKVSTDGIFVLHTEFCAMNQSRPDQQKMIIIFAFT--VFFV 228

  Fly   279 GPMTAICVLYVLIGVKLKRSRL----LQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPF 339
            .|..||.::|..|.|:|:.|.:    .:.:.:|...:||      .|::||::|.:.||:||.||
 Worm   229 IPAIAIVIMYAHIAVQLESSEIDLKGDKMVKKRRNKSNR------TVLKMLLSVVITFFICWLPF 287

  Fly   340 HAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITL 403
            |.|||::||........|| ........|:.|.||..|:.::..||:||||:|.|:|.||..|:
 Worm   288 HIQRLLSVYTTWSETTTIS-PPVQFLSMIVFYISGFCYYSNSAANPILYNILSQKYRSAFCRTI 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 57/129 (44%)
7tm_1 124..388 CDD:278431 100/296 (34%)
nmur-2NP_493666.2 7tm_4 42..286 CDD:304433 84/252 (33%)
7tm_1 48..335 CDD:278431 100/296 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
66.000

Return to query results.
Submit another query.