DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and LOC101732366

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_004918724.1 Gene:LOC101732366 ID: Length:373 Species:Xenopus tropicalis

Alignment Length:354 Identity:98/355 (28%)
Similarity:164/355 (46%) Gaps:67/355 (19%)


  Fly    92 STMAADSPVDE--------SLTLRTALTVCYALIFVAGVLGNLITCIVI--SRNNFMHTATNFYL 146
            ||.::..||.:        |:..::::::.|.|:..||:|||.:...|:  .|...:..:.:.::
 Frog     3 STTSSMPPVSKPPEAEVRLSIYAKSSISLTYMLLLFAGILGNAMVIRVLWGLRRRRVQASLSHHM 67

  Fly   147 FNLAVSDLILLVSGIPQELY-NLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAI 210
            .:||..||:.||.|||.||| ::|.|..:|..:..|.....|.|:...|.:..:.:.:.||::|.
 Frog    68 CSLASCDLLQLVLGIPAELYGSIWSPFPWPLGNIGCCGFYYLWEVLCYAAIFNVLSLSCERHLAT 132

  Fly   211 CHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQ--AMQFSVVY-------QNEGYSCT----MEN 262
            |.|...| :.:.|..::..| |||.:.|..||.  .|....||       ..|.:.||    .:.
 Frog   133 CRPLSLH-LRQSSVRLRLCF-IWLMSLLAGLPVLFTMGLEDVYAADVDDQHTELWVCTPLSSRKG 195

  Fly   263 DFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRSR------------------LLQSLPRRTF 309
            .|.|.::|  .|:.:.|.::       ::|:...|.|                  .:|.|.|  |
 Frog   196 LFVATIWA--SFLTYLGVLS-------VVGITCWRMRRALQGSASQDVEVAGPGGSVQLLGR--F 249

  Fly   310 DANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFND-YFR---ILD 370
            .:.:.:.|:.:..|||..:..|..:||.||.|:|||.|..        |:|.:.: |:|   .|.
 Frog   250 CSGQTVTARKQNARMLGCIVGALAVCWLPFQARRLMTVLR--------SKDQWTENYYRSYITLQ 306

  Fly   371 YTSGVLYFLSTCINPLLYNIMSHKFREAF 399
            ..:...|:||:|:.|||||:.|..||.||
 Frog   307 PITNCFYYLSSCLTPLLYNLTSQSFRRAF 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 41/131 (31%)
7tm_1 124..388 CDD:278431 81/302 (27%)
LOC101732366XP_004918724.1 7tm_1 43..324 CDD:278431 81/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.